PatentDe  


Dokumentenidentifikation DE3856004T2 18.12.1997
EP-Veröffentlichungsnummer 0318179
Titel VERWENDUNG VON MONOCLONALEN REZEPTOREN GEGEN ONCOPROTEINEN ZUR ÜBERWACHUNG VON KREBSTHERAPIE
Anmelder Ligand Pharmaceuticals, Inc., San Diego, Calif., US
Erfinder Niman, Henry Lee, Carlsbad, CA 92008, US
Vertreter Rechts- und Patentanwälte Lorenz Seidler Gossel, 80538 München
DE-Aktenzeichen 3856004
Vertragsstaaten AT, BE, CH, DE, ES, FR, GB, GR, IT, LI, LU, NL, SE
Sprache des Dokument En
EP-Anmeldetag 09.11.1988
EP-Aktenzeichen 883105405
EP-Offenlegungsdatum 31.05.1989
EP date of grant 20.08.1997
Veröffentlichungstag im Patentblatt 18.12.1997
IPC-Hauptklasse G01N 33/574
IPC-Nebenklasse G01N 33/577   

Beschreibung[de]

Die vorliegende Erfindung betrifft die Überwachung einer Krebstherapie und im besonderen die Verwendung eines Panel- bzw. Felder-Assays zu diesem Zweck, welcher gegen Polypeptide, deren Aminosäurerest-Sequenzen den Sequenzen der Liganden retroviraler Onkoproteine entsprechen, erzeugte, monoklonale Rezeptoren verwendet.

Hintergrund der Erfindung

Retroviren sind Viren, die als genetisches Material einen Einzelstrang von RNA anstelle von DNA enthalten. Das einzelsträngige RNA-Genom jedes dieser Viren erzeugt ein doppelsträngiges DNA-Molekül, nachdem das Virus einen empfanglichen Wirt inliziert hat. Diese DNA-Replica des viralen Genoms führt sich dann selbst dauerhaft in ein Chromosom der erfolgreich infizierten Zelle ein und repliziert in diesem Wirtschromosom.

Die nachfolgend und in den Ansprüchen erörterten Retroviren können des weiteren als Retroviren, die replikationsdefekt sind, definiert werden. Daher enthalten diese Viren selbst kein Gen, das die reverse Transkriptase codiert, die gewöhnlich erforderlich ist, um dem viralen RNA-Genom zu gestatten, in eine DNA übersetzt zu werden, welche in ein Chromosom des infizierten Wirts eingeführt werden kann. Stattdessen müssen die hier nachfolgend erörterten Retroviren typischerweise bei ihrer Infektion durch einen sogenannten Helfervirus, der replikationskompetent ist, komplementiert werden. Dieses zweite Virus enthalt das Gen, das für das Enzym reverse Transkriptase codiert, welches die Genom-Materialien aus beiden Viren in die erfolgreich infizierten Wirtszellen einbaut, um diese Zellen zu transformieren.

Zum einfachen Verständnis werden die replikationsdefekten Retroviren hier nachfolgend und in den Ansprüchen nur als Retroviren erörtert, bei denen zu verstehen ist, daß sie replikationsdefekt sind und die Unterstützung eines Helfervirus für eine erfolgreiche Infektion und Transformation von Wirtszellen benötigen. Diese Verwendung des Begriffs "Retrovirus" ist im Fachbereich bekannt und wurde im Fachbereich als solcher ohne weitere Erklärung verwendet.

Einige Mitglieder der Familie der Retroviren sind in hohem Maße onkogen, wie dies aufgrund ihrer Fahigkeit beurteilt wird, die Bildung solider Tumore innerhalb einer kurzen Zeitdauer, nachdem sie in den Wirt inokuliert wurden, zu verursachen. Diese Viren können ebenfalls "krebsartige" Veränderungen in Zellen, die im Labor herangezogen und kultiviert wurden, hervorrufen. Solche Veränderungen werden als "Transformationen" bezeichnet und stellen einen verläßlichen biologischen In-Vitro-Assay für onkogene Viren zur Verfügung. Einige solcher Viren wurden aus Hühnern, Truthähnen, Mäusen, Ratten, Katzen und Affen isoliert.

Ein einzelnes Gen, das Onkogen, das in dem Genom dieser in hohem Maße onkogenen Viren liegt, ist für das Tumorerzeugungsvermögen des Virus verantwortlich. Im Falle einiger Viren wurden die Proteinprodukte ihrer Onkogene, hierin als Onkoproteine bezeichnet, immunologisch identifiziert, indem man einen Vorteil aus der Tatsache zog, daß das Serum aus einem einen virusinduzierten Tumor tragenden Tier gegen diese Onkoproteine gerichtete Antikörper enthält.

Eine rasch anwachsende Beweismenge zeigt, daß die Onkogene von Retroviren mit spezifischen genetischen Loci in der normalen zellulären genetischen Information aller Vertebraten nahe verwandt und daraus abgeleitet sind.

Das Interesse an Onkogenen hat sich im letzten Jahrzehnt ständig vergrößert. Obwohl RNA- Tumorviren seit über 50 Jahren als ursächliche Agenzien mit experimentell induzierten Neoplasien in Hühnern in Zusammenhang gebracht werden, begannen sich erst in der Mitte der 1970er Mechanismen von viral induzierter Neoplasie herauszustellen [Bishop (1983) Ann. Rev. Biochem. 52: 301-54]. Einem solchen Mechanismus entsprechend, hatten replikationskompetente Vogelviren und defekte Säugerviren zelluläre Gene eingefangen, die die Viren mit einem transformierenden Potential ausstatteten.

Molekulare Hybridisierungsuntersuchungen, die spezifische Nukleinsäuresonden verwendeten, gefolgt von dem genetischen Klonieren viraler Onkogene und ihrer zellulären Verwandten mittels rekombinanter DNA-Technologie, haben die Verwandtschaft zwischen retroviralen Onkogenen (v-onc) und zellulären Onkogenen (c-onc), die in allen normalen Vertebratenzellen gefünden werden, bewiesen. Die molekulare Analyse der mehreren, bisher isolierten Retroviren hat mehr als zwei Dutzend unterschiedliche Onkogene enthüllt. In den meisten Fällen wurde ein dem retroviralen Onkogen oder Onkoprotein entsprechendes zelluläres Protein isoliert.

Es wurde zum Beispiel das humane EJ- oder T24-Blasenkarzinom-Onkogen als das Homologe des transformierenden Gens des Harvey-Mäuse-Sarkom-Virus (rasHa) und ebenfalls des BALB-Sarkom-Virus (bas) identifiziert (Parada et al., (1982) Nature 297: 474-478, Der et al., (1982) Proc. Natl Acad. Sci. USA 79: 3627-3634, und Santos et al., (1982) Nature 298: 343- 347). Zusätzlich wurde herausgeflinden, daß das Onkogen der humanen Karzinomzellinie LX-I dem transformierenden Gen des Kirsten-Stamms des murinen Sarkomvirus (rasKi) homolog ist (Der et al., siehe oben). Außerdem ist das v-onc für ein als fps bezeichnetes, aus Vögeln stammendes, c-onc wemgstens zweimal in einer begrenzten Anzahl von Isolaten von Vogel- Retroviren vertreten. Sein als "fes" bezeichneter Säugerverwandter in Katzen-Spezies wird in zwei verschiedenen Stämmen von Katzen-Sarkomviren gefünden

Die Homologie (Doolittle et al. (1983) Science 221: 275-277, Waterfield et al (1983) Nature 304: 35-39) zwischen dem Genprodukt des Onkogens sis und einer der Ketten des von Blutplättchen abgeleiteten Wachstumsfaktors bzw. "Platelet-derived Growth Factor" sorgte für den stärksten Zusammenhang zwischen einer malignen Transformation durch Onkogene und der Stimulation der normalen Zellteilung durch Wachstumsfaktoren. Diese Identität zwischen Onkogenprodukten und Wachstumsfaktoren und zellulären Rezeptoren wurde mit der Sequenzanalyse des zellulären Rezeptors für den epidermalen Wachstumsfaktor weiter bestätigt (Downward et al., (1984) Nature 307: 521-527, Ullrich et al., (1984) Nature 309: 418-425), von dem gefünden wurde, daß er das normale Homolog von erbB ist. Des weiteren zeigte die immunologische Kreuzreaktivität von Antikörpern gegenfins mit dem Rezeptor für den Kolonie-stimulierenden Faktor-1 (Sherr et al., (1985) Cell: 665-676) sowie die Proteinkinasehomologie mit dem Insulinrezeptor (Ullrich et al., (1985) Nature 313: 756-761) und dem Rezeptor für den von Blutplättchen abgeleiteten Wachstumsfaktor (Yarden et al., (1986) Nature 323: 226-232), daß die Kinaseaktivität vieler der sequenzierten Onkogene bei der Signaltransduktion einiger Wachstumsfaktoren wichtig sein wurde.

Die Sequenzierung von Onkogenen, die von Retroviren eingefangen worden waren oder die über Transfektionsexperimente identifiziert wurden, erweiterte in großem Maße die Anzahl der Mitglieder der Kinasefamihe (Hunter et al., (1985) Ann. Rev. Biochem. 54: 897-930). Diese Sequenzanalyse legte nahe, daß die Anzahl der kinaseverwandten Proteine groß ist und daß die Mitglieder der Familie, basierend auf der Sequenzhomologie und Gesamtstruktur-Almlichkeiten in Untergruppen unterteilt werden können. Die Familie der Kinasen kann angemessenerweise in Genprodukte eingeteilt werden, die extrazelluläre (Hormon/Wachstumsfaktor-) Bindungsdomänen aufweisen oder nicht.

Die starke Ähnlichkeit zwischen dem Kinaseanteil von src und yes war seit einigen Jahren offensichtlich (Kitamura et al., (1982) Nature 297: 205-208). Vor kurzem hat die Sequenzierung weiterer Gene diese Homologie auf fgr (Naharro et al., (1984) Science 222: 63-66), lck (Marth et al., (1985) Cell 43: 393-404), syn (Semba et al., (1986) Proc. Nail Acad. Sci. USA 83:5 459-5 463) und lyn (Yamanashi et al., (1987) MoL and Cell Biol 1: 237-243) ausgedehnt. Alle diese sechs Gene codieren Proteine von etwa derselben Größe von 55-65 kDa, und die Gene haben Intron/Exon-Grenzen gemeinsam, was zeigt, daß sie sich aus demselben Ur- Protoonkogen entwickelt haben. Jedes Gen ist jedoch auf einem separaten Chromosom lokalisiert und exprimiert unterschiedliche Proteine in unterschiedlichen Geweben.

Viele zusätzliche Mitglieder der Kinasefamihe können ebenfalls in Untergruppen eingeteilt werden. Mos (Van Beveran et al., (1981), Nature 289: 258-262) ist nahe mit pim-1 (Selten et al, (1986) Cell 46: 603-611) verwandt, einer der bevorzugten Integrationsstellen des Moloney-Leukämie-Virus. Abl (Reddy et al., (1983) Proc. Natl. Acad. Sci. USA 80: 3 623-3 627) ist nahe mit arg (Kruh et al., (1986) Science 234:1 545-1 547) verwandt. Fes (Hampe et al., (1982) Cell 30: 775-785) und fps (Shibuya et al., (1982) Cell 30: 787-795) repräsentieren die Säuger- und Vogel-Gegenstücke desselben Gens. In ähnlicher Weise sind raf (Sutrave et al., (1984) Nature 309: 85-88) und mii (Mark et al., (1984) Science 224: 285- 289) die Säuger- und Vogelhomologen desselben Gens. Sie sind nahe verwandt mit A-raf/pks (Huleihel et al., (1986) MoL and Cell Biol 6: 2 655-2 662, Mark et al., (1986) Proc. Natl. Acad. Sci. USA 83: 6 312-6 316).

Eine Untergruppe, die kein virales Gegenstück hat, enthält die Gene, die für die Proteinkinase C codieren, den Rezeptor für Phorbolester. Es gibt wenigstens drei nahe verwandte, diese Untergruppe ausmachende Gene (Coussens et al., (1986) Science 233: 859-866, Knopf et al., (1986) Cell 46: 491-502). Darüber hinaus kann eines der Gene für zwei Proteine über eine alternative Exonverwendung codieren (Ohno et al., (1987) Nature 325: 161-166). Andere, entfernter verwandte zytoplasmatische Kinasen schließen die CAMP- und cGMP- abhängige Proteinkinase ein (Shoji et al., (1981) Proc. Natl. Acad. Sci. USA 78: 848-851, Takio et al., (1984) Biochemistry 23: 4 207-4 218), sowie die Myosin-Leichte-Kette-Kinase (Takio et al., (1985) Biochemistry 24: 6 028-6 037). Auch mehrere Transmembrankinasen wurden in den letzten Jahren sequenziert.

Auch wurde ein nahe mit dem humanen Epidermalen-Wachstumsfaktor-Rezeptor (HER) verwandtes Gen in Menschen (HER-2) (Coussens et al., (1985) Science 230:1132-1139) und Ratten (neu) (Bargmann et al., (1986) Nature 319: 226-230) gefunden. Der Wachstumsfaktor, der an ros bindet (Neckameyer et al., (1985) J Virol. 53: 879-884), ist nicht bekannt, obwohl die Sequenz am nächsten mit dem Insulinrezeptor (HIR) verwandt ist (Ullrich et al., (1985) Nature 313: 756-761). Der Rezeptor für den Kolonie-stimulierenden Faktor 1, FMS (Hampe et al., (1984) Proc. Natl Acad. Sci. USA 81: 85-89) bildet mit kit (Besmer et al., (1986) Nature 320: 415-421) und mit dem Rezeptor für den von Blutplättchen abgeleiteten Wachstumsfaktor, PDGF-R (Yarden et al., (1986) Nature 323: 226-232) eine Untergruppe. Zusätzlich sind die Sequenzen für die Onkogene frk (Martin-Zanca et al., (1986) Nature 319: 743-748) und met-8 (Dean et al., (1985) Nature 318: 385) publiziert worden, obwohl die entsprechenden Wachstumsfaktoren nicht bekannt sind.

Eine ähnliche, wenn auch nicht so extensive Ausweitung, war ebenfalls für die durch die ras- Onkogenfamihe repräsentierten nukleotidbindenden Proteine ersichtlich. Die Sequenzdaten deuten darauf hin, daß bas (Reddy et al., (1985) J Virol 53: 984-987) die Mäuse-Form von H-ras ist (Dhar et al., (1982) Science 217: 934-937), und daß die Produkte H- und K-ras prinzipiell in der Carboxylregion voneinander abweichen (Tsuchida et al., (1982) Science 217: 937-939). Durch alternative Exons kann K-ras für 2 Proteine codieren (4A und 4B) (McGrath et al., (1983) Nature 310: 501-506). Ein drittes Mitglied, N-ras weicht in diesem Bereich ebenfalls von H- und K-ras ab (Taparowsky et al., (1983) Cell 34: 581-586). Ein anderes, nahe verwandtesßen ist R-ras (Lowe et al., (1987) Cell 48:137-146). Obwohl dieses Gen nahe mit den drei ras-Genen, die sich aus demselben Ur-Gen entwickelt haben, verwandt ist, hat R-ras andere Intron/Exon-Grenzen. Ein anderes Gen, rho-7 (Madule et al., (1985) Cell 41: 31-40) hat verstreute Bereiche der Honiologie mit ras. Darüber hinaus hat eine dritte Gruppe, ral, ebenfalls ahnliche Bereiche der Homologie (Chardin et al., (1986) EMBO J 5: 2 203-2 208). Darüber hinaus hat ein Hefegcn ypt (Gallwitz et al., (1983) Nature 306: 704-707) Bereiche der Homologie mit ras, und dieses Gen ist von den zwei Hefegenen, die eine ausgedehnte Homologie mit ras haben, verschieden, d.h. jene sind ähnlicher zu R-RAS.

Andere Gene, die ebenfalls eine Homologie mit ras haben, schließen die G-Proteine ein (Itoh et al., (1986) Proc. Natl Acad Sci. USA 83: 3 776-3 780) sowie Transducin und den Elongationsfaktor Tu (Lochrie et al., (1985) Science 228: 96-99). Die G-Proteine sind aus Untereinheiten zusammengesetzt, welche die Adenylatcyclase stimulieren (Gs) und inhibieren (Gi). Ein anderes verwandtes Protein (G0) hat eine unbekannte Funktion. Diese Proteine existieren in einer Vielfalt unterschiedlicher Formen, die nahe verwandte Sequenzen haben.

Die nukleären Proteine myb (Rushlow et al., (1982) Science 216:1 421-1 423), myc (Colby et al., (1983) Nature 301: 722-725) und fos (van Straaten et al., (1983) Proc. Natl. Acad. Sci. USA 80: 3183-3187) bilden eine weitere Familie von Onkogenen, die mehr durch ihre zelluläre Lokalisation als durch ihre Sequenz verwandt sind. Es wurden jedoch zusätzliche Gene, welche mit diesen Onkogenen verwandt sind, identifiziert. Die Sequenzen von N-myc (Stanton (1986) Proc. Natl. Acad. Sci. USA 83:1772-1776) und L-myc (Nau et al (1985) Nature 318: 69-73) wurden publiziert und nicht-publizierte verwandte Sequenzen wurden identifiziert. Darüber hinaus sind die Sequenzen entfernt mit fos verwandt. Eine verwandte fos-Sequenz (r-fos) (Cochran et al., (1984) Science 226:1080-1082) wurde publiziert, und nicht-publizierte Daten deuten darauf hin, daß ein Phosphorylaseinhibitor eine begrenzte Homologie anlweist, wie auch das Onkogen jun.

Eine andere Gruppe nukleärer, mit Onkogenen verwandter Proteine, schließt die Steroid- und Thyroidhormonrezeptoren ein. Obwohl nur eine mit erba verwandte Sequenz publiziert worden ist (Sap et al., (1986) Nature 324: 635-640; Weinberger et al., (1986) Nature 324: 641-646), deuten Hybridisierungsuntersuchungen darauf hin, daß wenigstens zwei verwandte Sequenzen im humanen Genom vorhanden sind (Weinberger et al., (1986) Nature 324: 641- 646). Die Steroidrezeptorsequenzen deuten daraufhin, daß erba (der Thyroidhormonrezeptor) Teil einer Überfatmije ist, welche verschiedene Rezeptoren einschließt (Östrogen, Glucocorticoid, Progesteron, Aldosteron) (Greene et al., (1986) Science 231:1150-1153; Hollenberg et al., (1985) Nature 318: 635-641; und Connelly et al., (1986) Science 233: 767-770).

In der Gruppe der Wachstumsfaktoren hat nur die PDGF-1-Kette (Doolittle et al., (1983) Science 221: 275-277 und Waterfleld et al., (1983) Nature 304: 35-39) eine Sequenzhomologie mit sis (PDGF-2). Es binden jedoch andere Wachstumsfaktoren (Gregory (1975) Nature 257: 325-327, Marguardt et al. (1983) Proc. Natl. Acad Sci. USA 80: 4 684-4 688) (EGF und TGF) an das Produkt des Protoonkogens erbB, und CSF-1 (Kawasaki et al., (1985) Science 230: 291-296) bindet an das Protoonkogenftns. Daruber hinaus bildet TGF (Derynk et al., (1985) Nature 316: 701-705) eine weitere Untergruppe aufgrund von Homologien mit der Müllerschen inhibitorischen Substanz bzw. "Mullerian inhibitory substance" (Cate et al., (1986) Cell 45: 685-698), und den drei Ketten, die in den unterschiedlichen Formen von Inhibitin gefünden werden (Mason et al., (1985) Nature 318: 659-663 und Vale et al., (1986) Nature 321: 776-779).

Schließlich wurden die Sequenzen, die zwei der bevorzugten Integrationsstellen von MMTV darstellen, veröffentlicht (Van Ooyen et al., (1984) Cell 39: 233-240 und Moore et al., (1986) EMBO J. 5: 919-924).

Somit hat sich in den letzten Jahren die Anzahl der verwandten publizierten Sequenzen in dramatischer Weise erhöht. Diese Sequenzen legen nahe, daß eine begrenzte Anzahl von die Zellteilung und -differenzierung kontrollierenden Pfaden existiert, aber daß viele unterschiedliche Mitglieder an dieser Kontrolle teilhaben können.

Ein Beispiel für die Transduktion von nur einem Teil eines zellulären Gens durch ein Retrovirus ist das Onkogen erbB. Das Onkogen erbB ist in hohem Maße zu einem Abschnitt des ECG-Rezeptors homolog (Ullrich et al., (1984) Nature 309: 418), wie bereits bemerkt wurde. Eine Sequenzanalyse des gesamten Rezeptorgens weist die Verwandtschaft von erbB mit der gesamten intrazellulären Domäne, der Transmembrandomäne und einem Teil der extrazellulären Domäne nach.

Das von dem viralen Onkogen codierte Protein und das entsprechende homologe Protein innerhalb der Wirtszelle werden hierin beide als Onkoproteine bezeichnet, obwohl das zelluläre Onkoprotein typischerweise größer ist und in normalen Zellen in kleinen Mengen vorhanden ist und daher nicht nur mit neoplastischen Zuständen assoziiert sein muß. Zusätzlich können von verwandten Onkogenen codierte Onkoproteine unterschiedliche Molekulargewichte aufweisen, z.B. die Onkoproteine p85 und p108, die von v-fesST bzw. v-fesGA codiert werden, und das 100-105 Kilodalton (auch kDa oder K Dalton) große Protein von normalen Nerzzellen, von dem man glaubt, daß es von dem c-fes-Gen codiert wird (Sen et al., (1983) Proc. Natl Acad Sci. USA, 80: 1 246-1 250). Der Begriff Onkoprotein wird daher hierin im allgemeinen für Proteine verwendet, deren Gene und Aminosäurerest-Sequenzen wenigstens zum Teil homolog sind, wie hier nachstehend erörtert.

Das Onkoprotein ist im allgemeinen nicht in dem Viruspartikel, der die Zelle infiziert vorhanden, sondern wird erst nach der Infektion und Transformation exprimiert. Das entsprechende zelluläre Onkoprotein wird in normalen Zellen höchstens in minimaler Weise und in einem größeren Ausmaß in neoplastischen Zellen exprimiert. Daher kann das Onkoprotein typischerweise nicht aus dem Virus erhalten werden. Zusätzlich wird die Isolation von Onkoproteinen aus Zellen wegen der geringen vorhandenen Menge, wegen der komplexen Mischung von in normalen Zellen gefündenen Proteinen und der selbst in transformierten Zellen vorhandenen relativ kleinen Menge solcher Proteine erschwert.

Von v-onc- und c-onc-Genen codierte Onkoproteine enthalten daher typischerweise große Sequenzen von Aminosäureresten, die homolog aber dennoch gewöhnlich nicht identisch sind. Darüber hinaus hat man gefünden, daß die von Genen unterschiedlicher viraler Stämme codierten Onkoproteine, von denen ein jeder scheinbar dasselbe Onkogen enthält, leichte Variationen in ihren Aminosäurerest-Sequenzen aufweisen, wie oben und durch die vier publizierten Sequenzen des ras-Gens, welche an der Position des zwölften Aminosäurerests voneinander abweichen, beispielhaft gezeigt wurde. Daher kann es sogar wenn man die Onkoproteine an der Hand hat, schwer sein, zwischen ihnen zu unterscheiden.

Immunologisch induzierte Rezeptormoleküle, wie monoklonale und polyklonale Antikörper oder die Idiotyp-enthaltenden Teile dieser Antiköper, sind nützlich bei der Reinigung von Proteinliganden, an welche sie binden, als diagnostische Reagenzien zur Untersuchung des Vorhandenseins und der Menge der Proteinliganden, sowie für die Unterscheidung zwischen homologen Proteinliganden.

Früher bestand viel Interesse daran, Antikörper gegen mit Onkogenen verwandte Proteine, insbesondere für diagnostische Zwecke, zu erhalten. Die EP-A-0 206 065 lehrt, daß monoklonale Antikörper gegen mit Onkogenen verwandte Proteine verwendet werden können, um solche Proteine in Proben von extrazellulärer Flüssigkeit, z.B. Serum von Krebspatienten, nachzuweisen. Niman et al., (1985) Proc. Natl Acad Sci. USA 82: 7 924-7 928 berichtet von Untersuchungen über die Verwendung polyklonaler Antiseren, erzeugt gegen synthetische Peptide, welche eine Teilsequenz eines Onkoproteins repräsentieren, um erhöhte Mengen von mit Onkogenen verwandten Proteinen in Urinproben von Krebspatienten nachzuweisen.

Anti-ras-Protein-Antikörper wurden ebenfalls verwendet, um die Expression von Mitgliedern der ras-Proteinfamihe in Krebszellen zu untersuchen. Zum Beispiel berichten Shen et al., (1987) Oncogene 1: 157-163 von einer Untersuchung der Expression von mit den drei ras- Genen H-ras, N-ras und K-ras verwandten Polypeptiden in humanen leukämischen Zellen, in welcher eine Immunpräzipitation solcher Polypeptide mit einer zweidimensionalen Gelelektrophorese verknüpft war. Bizub et al., (1987) Oncogene 1: 131-142, beschreiben die Verwendung synthetischer Peptide, welche einem Bereich mit hoher Variabilität eines ras- Proteins entsprechen, um polyklonale Antiseren mit einer Spezifität für ein besonderes ras- Protein zu erhalten, und die Verwendung solcher Antiseren, um die Expression von ras-Protein in einem Maus-Modellsystem für chemische Karzinogenese zu untersuchen.

Ein neuer Ansatz, um eine Krebstberapie zu überwachen, wird nun zusätzlich durch die Erfindung der vorliegenden Beschreibung bereitgestellt, abhängig vom Vergleich der Reaktivitätsmuster geeigneter biologischer Proben gegen eine Auswahl bzw. ein Panel monoklonaler Rezeptormoleküle, z.B. monoklonaler Antikörper, die fähig zum Nachweis von Onkogen-verwandten Proteinen sind.

Geeignet für ein Verfahren der vorliegenden Erfindung sind monoklonale Rezeptormoleküle, welche sowohl (a) an einen von einem Onkogen eines Retrovirus codierten Proteinliganden als auch (b) an ein Polypeptid mittlerer Länge von etwa 7 bis etwa 40 Resten, und bevorzugtermaßen von etwa 10 bis etwa 30 Aminosäureresten, mit einer einem Teil desselben Onkogencodierten Proteins entsprechenden Aminosäuresequenz, binden. Das Rezeptormolekül wird erzeugt gegen (induziert durch) ein das Polypeptid enthaltendes Immunogen. Das Rezeptormolekül ist, am meisten bevorzugt, ein monoklonaler Rezeptor der IgG-Klasse der Immunglobuline.

Als Hintergrund zu der nun beschriebenen Erfindung wird zusätzlich auf Arnheiter et al., (1981) Nature 294: 278-230 Bezug genommen, welcher die Erzeugung monoklonaler Antikörper gegen ein Polypeptid von 56 Aminosaureresten, das dem carboxyterminalen Anteil eines intakten Interferonmoleküls entspricht, beschreibt. Das relevante 56-mere Polypeptid entsprach etwa einem Drittel der Sequenz des intakten Moleküls.

Arnheiter et al., berichteten von der Produktion von elf monoklonalen Antikörpern. Jedoch hat nur einer von diesen monoklonalen Antikörpern sowohl an das Polypeptid-Immunogen als auch an das intakte Interferonmolekül gebunden. Darüber hinaus war diese Bindung nicht sehr stark, wie nach dem 3000-fachen Überschuß an intaktem Interferon, der erforderlich war, um den Antikörper von dem synthetischen Polypeptid wegzukompetitieren, geschlossen wird. Keiner der anderen monoklonalen Antikörper hat an das intakte Molekül gebunden.

Darüber hinaus erforderte die Erzeugung der diese monoklonalen Antikörper sezemierenden Hybridome die Milzen von drei immunisierten Mäusen. Der niedrige Ertrag an den erwünschten, das Interferon bindenden monoklonalen Antikörpern, und die Tatsache, daß die Milzen von drei Mäusen für die Herstellung dieser Hybridomzellinien benötigt wurden, zeigen, daß diese Bearbeiter in ihren Bemühungen relativ erfolglos waren.

Lemer et al., hatten Erfolg dabei, einen Schutz von Tieren durch die Verwendung von Impfstoffen gegen Pathogene durch die Anwendung synthetischer Aminosäurerest-Sequenzen von kurzer bis mittlerer Länge als Immunogene zu erhalten, siehe Sutcliffe et al., (1983) Science 219: 495-497.

Es versteht sich jedoch, daß sich eine erfolgreiche Herstellung monoklonaler Antikörper gegen synthetische Peptide, welche einer Teilsequenz eines Onkoproteins entsprechen, von der erfolgreichen Herstellung eines oligoklonale Rezeptoren enthaltenden Impfstoffs unterscheidet. Daher ist es für die Herstellung von monoklonalem Antikörper bei hohem Ertrag nötig, B-Zellen dazu zu stimulieren, große Mengen avider Antikörper zu sezermeren. Andererseits kann für einen synthetischen Impfstoff ein breiteres Spektrum oligoklonaler Antikörper in geringeren Mengen und mit geringeren Aviditäten erzeugt werden. Darüber hinaus erfordert der Schutz eines Tiers gegen ein Pathogen typischerweise sowohl eine T-Zell- als auch eine B-Zell-Aktivierung, so daß eine zelluläre Antwort bzw. eine humorale Antwort in dem Tier induziert werden kann.

Eine beliebte Erklärung für den Erfolg von synthetische Polypeptide enthaltenden Impfstoffen bei der Erzeugung von Antikörpern, welche die intakten Proteine erkennen und die Wirtstiere schützen, schließt ein stochastisches Modell ein, in welchem die Diversität einer Immunantwort die Beobachtung eines seltenen Ereignisses erlaubt, d.h., daß das Polypeptid die Konformation seiner entsprechenden Sequenz in dem nativen Molekül annimmt. Das Konzept, daß Polypeptide von mittlerer Länge häufig mit nativen Strukturen übereinstimmen können, steht im Gegensatz zu theoretischen und experimentellen Untersuchungen. Stattdessen denkt man, daß solche Polypeptide als eine Gesamtheit bzw. ein Ensemble einer großen Anzahl von vorübergehenden Konformations-Zuständen existieren, welche in einem dynamischen Gleichgewicht stehen. Man glaubte, daß die T-Zell-Aktivierung durch und die B-Zell-Herstellung von Antikörper(n), die gegen einige Vertreter aus diesem Konformations-Ensemble herangezogen wurden, hinreichend sind, um Schutz nach einer Impfiing bereitzustellen.

Kurze Zusammenfassung der Erfindung

Gemäß einem Aspekt stellt die vorliegende Erfindung ein Verfahren zur Charakterisierung einer ersten biologischen Probe aus einem Individuum zum Zwecke der Überwachung einer Krebstherapie bei dem Individuum, bereit, umfassend die Schritte:

(a) Kontaktieren der ersten biologischen Probe mit mindestens zwei unterschiedlichen monoklonalen Rezeptormolekülen, welche beide an (i) einen durch ein Onkogen exprimierten Proteinliganden und (ii) ein Polypeptid mit einer Aminosäurerest-Sequenz, die etwa 7 bis 40 Aminosäuren, welche einem Abschnitt des Proteinliganden entsprechen, enthält, binden, wobei die monoklonalen Rezeptormoleküle gegen ein das Polypeptid enthaltendes Immunogen gezogen wurden, um ein erstes Reaktivitätsmuster zu erzeugen; und

(b) Vergleichen des ersten Reaktivitätsmusters mit einem zweiten Reaktivitätsmuster, welches durch eine bekannte biologische Probe erzeugt wurde, wobei das zweite Muster die Onkogenexpression oder die Expression Onkogen-verwandter Sequenzen durch das Individuum am Anfang der Therapie anzeigt.

Spezifische, bevorzugte monoklonale Rezeptormoleküle zur Verwendung in einem Verfahren der Erfindung binden an ein Protein, welches codiert wird von den unten aufgeführten Onkogenen, und ebenso an das/die Polypeptid(e), die diesen Onkogenen gegenüberstehend aufgelistet sind:

Man hat gefünden, worauf hierin zuvor hingewiesen wurde, daß bevorzugtermaßen synthetisch hergestellte immunogene Polypeptide von mittlerer Länge (etwa 7 bis etwa 40 Reste), die einem Teil eines Onkoproteins entsprechen, oder ein an einen Träger gebundenes Konjugat eines solchen Polypeptids, ein geeignetes Immunogen zur Erzeugung monoklonaler Rezeptormoleküle für ein Verfahren der Erfindung bereitstellen. Zum Beispiel hat man gefünden, daß ein geeignetes immunogenes Polypeptid, wenn es als ein Konjugat an einen Träger aus Schlüssellochnapfschnecken-Hämocyanin (keyhole limpet hemocyanin) gebunden ist und verwendet wird, um eine Maus zu immunisieren, hinreichend immunogen und antigen ist, um für einen Soprozentigen Bindungstiter des Serums der immunisierten Maus an das Polypeptid bei wenigstens einer Verdünnung von etwa 1:400 nach drei Immunisierungen, wobei eine jede wenigstens 10 Mikrogramm an Polypeptid in dem Konjugat enthält und komplettes Freundsches Adjuvans für die erste Immunisierung und Alaun als das Adjuvans bei der zweiten und dritten Immunisierung verwendet werden, zu sorgen.

Ein Säuger wird mit dem immunogenen Polypeptid oder eineni Konjugat dieses an einen Träger gebundenen Polypeptids, hyperimmunisiert, um ein Hyperimmunserum bereitzustellen, welches einen Soprozentigen Bindungstiter an das Polypeptid bei wenigstens einer Verdünnung von etwa 1:400 zeigt. Die Rezeptormoleküle dieses Serums binden ebenfalls an den Proteinmolekülliganden, dem das Polypeptid in der Aminosäurerest-Sequenz entspricht.

Der hyperimmunisierte Säuger wird wahrend eines Zeitraums von wenigstens etwa 30 Tagen nach der Verabreichung der Immunisierung, welche einen Soprozentigen Bindungstiter bei einer Verdünnung von wenigstens etwa 1:400 erzeugt, gehalten. Eine Booster- bzw. Verstärkungs-Immunisierung wie durch eine intravenöse Injektion, wird dem Tier danach verabreicht.

Antikörperproduzierende Zellen wie Milzzellen (Splenozyten) des geboosterten Säugers werden mit Myelomzellen innerhalb eines Zeitraums von etwa drei bis etwa fünf Tagen nach dem Tag der Booster-Verabreichung füsioniert, um Hybridomzellen herzustellen. Die auf diese Weise hergestellten Hybridomzellen werden bezüglich der Herstellung monoklonaler Rezeptormoleküle getestet, welche an einen Proteinmolekülliganden binden, wobei das immunogene Polypeptid einem Teil desselben hinsichtlich der Aminosäurerest-Sequenz entspricht. Bevorzugtermaßen werden die Hybridomzellen ebenfalls auf die Herstellung monoklonaler Rezeptormoleküle getestet, welche an das Polypeptid binden.

Die Hybridomzellen, welche monoldonale Rezeptormoleküle erzeugen, welche an den Proteinmolekülliganden binden, werden dann kultiviert, um eine zusätzliche Menge solcher Zellen herzustellen. In der bevorzugten Praxis sind diejenigen Hybridomzellen, die kultiviert werden auch diejenigen, welche monoklonale Rezeptoren herstellen, welche an das Polypeptid binden.

Bei einem anderen Aspekt der vorliegenden Erfindung handelt es sich um ein Kit zum Zwecke des Überwachens eines eine Krebstherapie erfahrenden Individuums. Ein derartiges Kit wird ein Reaktivitätsmuster, das durch das Kontaktieren einer biologischen Probe aus einem normalen Individuum mit mindestens zwei unterschiedlichen monoklonalen Rezeptormolekülen erzeugt wird, welche sowohl an (i) einen durch ein Onkogen exprimierten Proteinliganden als auch (ii) ein Polypeptid mit einer Aminosäurere-Sequenz, die etwa 7 bis 40 Aminosäuren enthält, welche einem Teil desselben von dem Onkogen codierten Proteins entsprechen, binden. Ein solches Kit wird ebenfalls wenigstens eine erste Packung einschließen, welche die zur Erzeugung desselben Reaktivitätsmusters geeigneten monokionalen Rezeptormoleküle enthält. Die Vermischung einer festgesetzten Menge dieser Rezeptoren mit einer festgesetzten Menge einer waßrigen Zusammensetzung, die auf die Gegenwart eines Onkoproteinliganden getestet werden soll, bildet durch eine immunologische Reaktion einen Rezeptor-Liganden- Komplex, wenn ein geeigneter Onkoproteinligand vorliegt, der eine Aminosäurerest-Sequenz einschließt, die einer Aminosäurerest-Sequenz eines durch ein Rezeptormolekül gebundenen Polypeptids entspricht. Das Vorhandensein des Komplexes kann durch eine Markierung, die bevorzugtermaßen in einer zweiten Packung des Kits enthalten ist, identifiziert werden.

Ein Kit der vorliegenden Erfindung kann auf eine Vielzahl von waßrigen Zusammensetzungen angewandt werden, einschließlich Serum, Zellextrakten, Amnionflüssigkeit, Urin oder einem Urinkonzentrat. Urin oder ein Urinkonzentrat wird zum Beispiel bevorzugt, weil es leicht durch nicht-invasive Mittel erhalten wird und, falls nötig, leicht weiter konzentriert werden kann, um die Durchführung eines Tests gemaß der Erfindung zu gestatten.

Um ein Verfahren der Erfindung auszuführen, wird eine Körperprobe, die auf das Vorhandensein eines Onkoproteinliganden getestet werden soll, wie Serum, ein Zellextrakt, Anmion flüssigkeit, Urin oder ein Urinkonzentrat, einer flüssigen, die Anti-Onkogen-Rezeptormoleküle enthaltenden Lösung beigemischt. Die auf diese Weise gebildete Mischung wird wahrend eines Zeitraums, welcher hinreichend ist, daß sich ein Komplex (Immunkomplex, Reaktionsprodukt oder Immunreaktant) zwischen einem Onkoproteinliganden und einem Rezeptormolekül (Antigen-Antikörper-Komplex) bildet, aufrechterhalten. Das Vorhandensein eines Komplexes wird danach bestimmt.

Die Bestimmung des Vorhandenseins eines Immunreaktanten kann typischerweise unter Verwendung eines Radioisotop- oder Enzym-markierten Antikörpers oder durch das Protein A von Staphylococcus aureus, welches an den Rezeptor des gebildeten Immunkomplexes bindet, ausgeführt werden.

Kurze Beschreibung der Zeichnungen

Bei den Zeichnungen, die einen Teil dieser Beschreibung bilden:

ist die Figur 1 eine Fotographie einer Autoradiographie, welche einen immunologischen Assay zur Detektierung des Vorhandenseins des Onkoproteins v-fes von ST-FeSV darstellt. Die Zellextrakte von etwa 10&sup5; MSTF-Zellen, einer produktiv transformierten Nerzzellinie, infiziert mit dem Snyder-Theilen-Stamm des Katzen-Sarkomvirus (ST-FeSV) und dem Katzen- Leukämievirus-B (FeLV-B) (Sen et al., (1983) Proc. Nah. Acad. Sci. USA 80:1 246-1 250), wurden in einem 5-17prozentigen Polyacrylamidgel einer Elektrophorese unterzogen und dann auf Nitrozelluloseblätter transferiert. Die transferierten Proteine wurden dann mit den Überständen von den als S10F03 (Spur 1) oder S22C06 (Spur 2) bezeichneten Hybridomgewebekulturen oder einem Anti-Influenza-Hämagglutinin-Hybridom, welches als Negativkontrolle verwendet wurde, zur Reaktion gebracht. Dieses Verfahren der Polyacrylamidgel-Auftrennung, gefolgt von einem Transfer aüf Nitrozellulose und einer Sichtbarmachung, wird hier nachstehend als Westem-Blot-Verfahren bezeichnet. Die Sichtbarmachung des Proteins wurde so vollzogen, wie es im Materialien- und Methodenteil hier nachstehend beschrieben wird.

Die Figur 2 ist eine Fotographie einer Autoradiographie, welche einen immunologischen Assay zum Nachweis des Vorhandenseins des als "p85" bezeichneten Fusionsproteins von FeSV (85 Kilodalton; 85 kD)) durch Western-Blot-Verfahren, ähnlich denjenigen von Figur 1, erläutert. Die Zellextrakte von etwa 2 x 10&sup6; MSTF-Zellen wurden in einem 5-17-prozentigen Polyacrylamidgel einer Elektrophorese unterzogen und dann elektrophoretisch auf Nitrozellulosestreifen transferiert. Die Streifen der Nitrozellulose wurden mit 5 Millilitern eines jeden 1: 50 verdünnten Hybridomkultur-Überstandes, von den als SI0F03 (Spur A), P43D09 (Spur B), P42C10 (Spur C), P44E11 (Spur D) bezeichneten Hybridomen, oder mit R&sub2;06B08, einem Anti-Rauscher-gp70-Protein-Rezeptor erzeugenden Hybridom (Niman und Elder, (1980), Proc. Natl Acad. Sci. USA 77: 4 524-4 528) als einer Negativkontrolle (Spur E), inkubiert.

Die Bindung wurde durch die Zugabe eines mit Peroxidase markierten Kaninchen-Anti-Maus- IgG sichtbar gemacht, wie es in dem Materialien- und Methodenteil hierin nachstehend erörtert wird. Der Marker "p85-" auf der linken Seite von Figur 2 erläutert die Migrationsposition des 85 kDalton ST-FeSV-Polyproteins, welches von demfes-Gen codiert wird.

Wie aus den Proteinen in Spur E ersehen werden kann, erlaubt diese Technik die Sichtbarmachung von Proteinmolekülen, welche nicht in spezifischer Weise durch die monoklonalen Rezeptoren von Interesse gebunden werden. Die Subtraktion der nicht spezifisch gebundenen Proteine, sichtbar gemacht in Spur E, von den in den Spuren A-D sichtbar gemachten Proteinen, zeigt, daß das einzige spezifisch gebundene Protein das p85-Onkoprotein ist, welches von v-fes codiert wird.

Die Figur 3 ist eine Fotographie einer Autoradiographie, welche einen Immunpräzipitations- Assay für das Vorhandensein des ³²P-markierten, als "p85" bezeichneten FeSV-Fusionsproteins darstellt. CCL64-Nerzzellen (MSTF-Zellen, Spuren B und D), oder die mit FeLV-B und FeSV infizierten (MSTF-Zellen, Spuren A und C), wurden jeweils 2 Stunden lang mit 1 Mikrocurie ³²P markiert. Die markierten Zellextrakte wurden dann mit 5 Mikrolitern Ziege- Anti-FeLV-p 15-Antikörpern (Spuren A und B) oder 50 Mikrolitern des Uberstandes des kultivierten Hybridoms S10F03 (Spuren C und D) ihkubiert. Die auf diese Weise hergestellten Immunkomplexe wurden unter Verwendung von das Protcin A exprimierenden Staphybcoccus aureus-Bakterien gesammelt. Die auf diese Weise gesammelten, prazipitierten Komplexe wurden gewaschen und daraufhin in ihre Teilkomponenten dissoziiert. Die Proteine wurden danach unter reduzierender, denaturierender Elektrophorese unter Verwendung eines 5-17prozentigen Polyacrylamidgels analysiert. Die Marker "p85-" und "pr65-" auf der linken Seite von Figur 3 erläutern die Migrationspositionen des 85 kD ST-FeSV-Fusionsproteins, codiert von dem fes-Gen, und dem 65 kD FeLV-gag-Vorläuferprotein.

Die Figur 4 ist eine Graphik, welche die Immunreaktivitäten oligokionaler Antikörper erläutert, welche gegen synthetische Polypeptide erzeugt wurden, die in der Aminosäurerest-Sequenz (i) den Positionen 139 bis 155 der vorausgesagten Sequenz des transformierenden, als p²&sup8;sis bezeichneten Proteins des Affen-Sarkom-Virus (Devare et al., (1983) Proc. Nall. Acad. Sci USA 80 731-735), hierin nachstehend als das Polypeptid (o) oder Nummer 113 und als PDGF 2 (73-89) kenntlich gemacht, und (ii) den Resten 2 bis 18 der vorausgesagten Aminosäurerest- Sequenz des Onkoproteins des Vogel-Myoblastose-Virus (Rushlow et al., (1982), Science 216: 1 421-1 423), hierin nachstehend als das Polypeptid (d) oder Nummer 131 kenntlich gemacht, entsprechen. Die mit dem Hämocyanin der Schlüssellochnapfschnecke (KLH) konjugierten synthetischen Polypeptide wurden verwendet, um Mäuse zu immunisieren, wie es allgemein im Materialien- und Methodenteil erörtert wird.

Um die Spezifität so hergestellter, oligoklonale Antikörper enthaltender Seren zu testen, wurden 250 Nanogramm des unkonjugierten Polypeptids oder 500 Nanogramm KLH auf den Böden von Mikrotitervertiefüngen angetrocknet und mit Methanol fixiert, wie von Niman und Elder in Monodonal Antibodies and T Cell Products; Katz (Hrsg.), CRC Press, Boca Raton, Florida, S. 23-51(1982), beschrieben. Die verbleibenden Anteile der Vertiefungen wurden gegen eine unspezifische Adsorption von Protein unter Verwendung von 3 % Rinderserumalbumin (BSA) und eines Inkubationszeitraums von 4 Stunden bei 37ºC abgeblockt.

In jede Vertiefung der Mikrotiterplatte wurden jeweils 25 Mikroliter von zweifachen Verdünnungen des Serums immunisierter Mäuse eingeträufelt, beginnend mit einer Verdünnung von 1:400, unter Verwendung von mit 10 %igem fötalen Kälberserum supplementiertem Gewebekulturmedium, und mit dem mit BSA geblockten Polypeptid oder KLH 16 Stunden lang bei 25ºC inkübiert. Nach zehnmaligem Waschen mit destilliertem Wasser wurden 25 Mikroliter Kaninchen-Anti-Maus-Kappa-Antikörper (Libbon Bionics Inc., Kensingbon, Maryland), 1:500 verdünnt mit 1 % BSA in phosphatgepufferter Kochsalzlösung (PBS), zugegeben und zwei Stunden lang bei 37ºC inkubiert. Nach zusätzlichem zehninaligen Waschen mit destilliertem Wasser wurden 25 Mikroliter mit Glucoseoxidase konjugiertes und 1:500 mit 1 % BSA in PBS verdünntes Ziege-Anti-Kaninchen-IgG hinzugegeben und 1 Stunde lang bei 37ºC inkubiert.

Die Menge der so gebundenen Glucoseoxidase wurde durch die Zugabe von 50 Mikrolitern einer 100 Mikrogramm/Milliliter ABTS-Farbstoff (Boehringer-Mannheim) enthaltenden Lösung in Gegenwart von 1,2 % Glucose und 10 Mikrogramm/ Milliliter Meerrettichperoxidase in 0,1 molarem Phosphatpuffer mit einem pH-Wert von 6,0 bestimmt. Die optischen Dichten der so hergestellten Lösungen werden bei 414 Nanometern unter Verwendung eines Titertech- Mikioscanners (Flow Laboratories Inc., Inglewood, Kalifornien) abgelesen.

Die Bindungen, die von den oligoklonalen Antikörpern in den gegen die sis-verwandten und die myb-verwandten Polypeptide erzeugten Seren gezeigt wurden, sind durch unausgefüllte bzw. ausgefüllte Symbole dargestellt. Die Antikörperantigene sind: das sis-verwandte Polypeptid (c) (O, ), myb-verwandtes Polypeptid (d)( , ,) und KLH ( , ).

Die Figur 5 ist eine Fotographie einer Autoradiographie, welche einen immunologischen Assay zum Nachweis des Vorhandenseins von nicht-reduziertem und reduziertem von Blutplättchen abgeleitetem Wachstumsfaktor (PDGF) unter Verwendung von Mäuse-Antiseren mit oligokionalen Antikörpern (Rezeptoren), induziert durch die synthetischen Polypeptide (c) und (d), als Sonden erläutert. Der PDGF-Extrakt wurde aus gealterten (outdated) Blutplättchen, wie im Materialien- und Methodenteil beschrieben, aufgereinigt.

Gereinigter PDGF-Extrakt aus etwa 2,5 Einheiten von Blutplättchen wurde mit einem minimalen Volumen einer 0,5 % Natriumdodecylsulfat (SDS) und 5 Prozent 2-Mercaptoethanol enthaltenden Lösung vermischt. Die resultierende Mischung wurde 2 Minuten lang gekocht und dann durch ein 5-17 prozentiges Polyacrylamidgel hindurch einer Elektrophorese unterzogen. Das Protein wurde danach elektrophoretisch auf Nitrozellulose transferiert (Niman und Elder (1982) virology 123:187-205), welche danach, im Anschluß an das Western-Blot- Verfahren, in Streifen geschnitten wurde.

Die so hergestellten Nitrozellulosestreifen wurden dann mit einer 3 % BSA, 0,1 % Polyoxyethylen-(9)-octylphenylether (Triton X- 100, Rohm and Haas Company, Philadelphia, PA) in PBS enthaltenden Lösung behandelt, um eine unspezifische Bindung von Protein zu inhibieren. 4 Milliliter des 1:200 verdünnten Mäuseantiserums wurden dann mit den Nitrozellulosestreifen inkübiert.

Nach dreimaligem Waschen mit einer Lösung von 0,1 % Triton X-100 in PBS wurden die Nitrocellulosestreifen entweder mit 106 Impulsen pro Minute bzw. cpm an ¹²&sup5;I-markiertem Protein A von Stapylococcus aureus (Spuren 2 und 3) oder einer Verdünnung von 1:1000 von Peroxidase-konjugiertem Ziege-Anti-Maus-Serum (Tago Inc., Burlingame, Kalifornien) inkubiert und wieder mit 1 % Triton X-100 in PBS gewaschen. Das Peroxidasekonjugat wurde mit einer 0,009 % H&sub2;O&sub2;, 0,0025 % 3,3'-Dimethoxybenzidindihydrochlorid (Eastman- Kodak Co., Rochester, New York) enthaltenden Lösung in einem lomillimolaren Tris-Puffer mit einem pH-Wert von 7,4 entwickelt. Die ¹²&sup5;1-markierten Streifen wurden durch eine Exposition auf einem XRP-1-Film (Eastman-Kodak Co., Rochester, New York) unter Verwendung von Cronex Hi-Plus Verstärkerschirmen (E.I. Dupont de Nemours & Co, Wilmington, Delaware) bei -70ºC 48 Stunden lang entwickelt.

Die Spur 1 enthält das mit Amidoschwarz gefärbte Gesamtprotein. Der gereinigte Plättchenextrakt ist mit Antiserum sondiert gezeigt, welches gegen das sis-verwandte Polypeptid (c) (Spuren 2 und 4) oder das myb-verwandte Polypeptid (d) (Spuren 3 und 5), als einer Negativkontrolle, erzeugt wurde. Externe Molekulargewichtstandards, basierend auf BSA, Ovalbumin, Chymotrypsinogen und Beta-Laktoglobulin sind auf der linken Seite gezeigt.

Die Figur 6 ist eine Fotographie einer Autoradiographie, welche einen immunologischen Assay für das Vorhandensein von PDGF, folgend einem Western-Blot-Verfahren, ähnlich zu dem hierin zuvor beschriebenen, erläutert. PDGF wurde in Gegenwart (Spuren A-F) oder in Abwesenheit (Spuren G-L) von 10 Prozent 2-Mercaptoethanol vor einer elektrophoretischen Proteinauftrennung, folgend dem in Niman (1934) Nature 307: 180-183 beschriebenen Verfahren, gekocht. Zwei oligoklonale Antikörper enthaltende Antiseren, induziert durch die aminoterminalen zwölf Aminosäurereste von PDGF-1 [bezeichnet PDGF-1 (1-12)] wurden in den Spuren A und G und den Spuren B und H verwendet. Zwei oligoklonale Antikörper enthaltende Antiseren, induziert durch ein Polypeptid aus einem zentralen Teil von PDGF-2 [bezeichnet PDGF-2 (73-89) und Polypeptid (o)], welches der Aminosäurerest-Sequenz an den Positionen 139 bis 155 von p28sis entspricht, wurden in den Spuren D und J und in den Spuren E und K verwendet. Oligoklonale Antikörper enthaltende Antiseren, induziert durch die aminoterminalen achtzehn Reste von PDGF-2 [bezeichnet PDGF-2 (1 - 18)] und durch die zwanzig Reste von PDGF-2, 36-16 Reste vom Carboxyterminus lokalisiert [bezeichnet PDGF-2 (126-145)], der Sequenz an den Positionen 191 bis 210 von p23sis entsprechend, wurden jeweils in den Spuren C und 1 bzw. den Spuren F und L verwendet. Die Antikörperbindung an die Proteine wurde unter Verwendung von Kaninchen-Anti-Maus-IgG, gefolgt von 10&sup6; cpm ¹²&sup5;I-markiertem Protein A von Staphylococcus aureus, wie in Niman, siehe oben, und im Materialien- und Methodenteil hier nachstehend beschrieben, sichtbar gemacht.

Die Figur 7 ist eine Fotographie einer Autoradiographie, welche einen immunologischen Test für das Vorhandensein eines 70 000 Dalton großen Proteins in drei Zellinien unter Verwendung eines Western-Blot-Verfahrens erläutert. Ein Extrakt von etwa 106 Zellen pro Spur wurde jeweils aus SSV-transformierten NIH 3T3-Zellen (Spuren A-E), TRD 1-Zellen (einer spontan transformierten Balb/3T3-Zellinie) (Spuren F-J) und MSTF-Zellen [einer Nerz- Lungenlinie (CCL64), produktiv infiziert mit FeLV-B und dem Snyder-Theilen-Stamm von FeSV] (Spuren K-O) auf Nitrozelluloseblätter, einem Western-Blot-Verfahren folgend, transferiert. Oligoklonale Antikörper enthaltende Antiseren, induziert durch PDGF-1 (1-12) wurden in den Spuren A-C, F-H und K-M verwendet. Oligokionale, von PDGF-2 (73-89) induzierte Antikörper enthaltende Antiseren wurden in den Spuren D, E, I, J, N und verwendet. Die Antiseren wurden mit 100 Mikrogramm der Polypeptide PDGF-1 (1-12) (Spuren A, D, F, I, K und N), PDGF-2 (1-18) (Spuren B, G und L) und PDGF-2 (73-89) (Spuren C, E, H, J, M und O) inkubiert, bevor sie mit den transferierten Zellextrakten zu einer Immunreaktion gebracht wurden. Die Proteine wurden wie für die Figur 6 beschrieben sichtbar gemacht.

Die Figur 8 ist eine Fotographie einer Autoradiographie, welche einen immunologischen Assay für das Vorhandensein des p2osis in Kulturmedien, die getrennt durch SSV-transformierte normale Rattennierenzellen und normale Rattennieren-(NRK)-Zellen konditioniert waren, erläutert.

Proteine aus konzentrierten Medien, aquivalent zu 25 Millilitern nicht-konzentrierten Medien, konditioniert durch SSV-transformierte Zellen (Spuren A, C, E und G) oder NRK-Zellen (Spuren B, D, R und H), wurden aufgetrennt und, dem Western-Blot-Verfahren folgend, auf Nitrozellulose transferiert. Die transferierten Proteine wurden dann mit oligokionalem Antikörper enthaltenden Antiseren versetzt, induziert durch PDGF-2 (1-18) (Spuren A-D) und PDGF-2 (73-89) (Spuren E-H). Die Seren wurden mit 100 Mikrogramm der Polypeptide PDGF-2 (73-89) (Spuren A, B, G und H) und PDGF-2 (1-10) (Spuren C, D, E und F) inkübiert, bevor sie mit den transferierten Proteinen zur Immunreaktion gebracht wurden. Die Immunreaktionen wurden, wie für die Figur 6 beschrieben, sichtbar gemacht. Der Marker "p20sis" auf der linken Seite von Figur 8 zeigt die Position von p20sis an.

Die Figur 9 ist eine Fotographie einer Autoradiographie, welche einen immunologischen Assay für das Vorhandensein von Proteinen, die codiert von oder verwandt mit sis- und fes-Antiseren sind, im Urin von humanen Krebspatienten, erläutert. Die flüssige Körperprobe in diesem Test war ein Urinkonzentrat, erhalten wie im Materialien- und Methodenteil beschrieben. Der konzentrierte Urin wurde in einem 5-17 %igen Polyacrylamidgel einer Elektrophorese unterzogen und dann elektrophoretisch auf Nitrozellulose gebracht.

Der Urin von drei Spendern wurde 200-fach konzentriert, dialysiert, und 20 Mikroliter eines jeden Konzentrates wurden einer Elektrophorese unterzogen, und die Proteine darin wurden auf Nitrozellulose transferiert, wie vorstehend beschrieben. Diese drei Spender hatten einen rektalen Tumor (Spuren A, D, G und J), einen Lebertumor (Spuren B, E; H und K) und ein Ewing-Sarkom (Spuren C, F, I und L). Ein oligoklonalen Rezeptor enthaltendes Antiserum, induziert durch das sis-verwandte Polypeptid PDGF-2 (73-89), das mit dem immunisierenden Polypeptid vorihkubiert worden war, wurde in den Spuren D-F verwendet, während dasselbe Antiserum, das mit dem fes-verwandten Polypeptid, welches der an den Positionen 744-759 des Onkoproteins v-fesST lokalisierten Sequenz entspricht, vorihkubiert worden war, in den Spuren A-C verwendet wurde. In ähnlicher Weise wurde ein oligoklonalen Rezeptor enthaltendes Antiserum, induziert durch das obengenannte fes-verwandte Polypeptid, welches mit dem immunisierenden Polypeptid vorihkubiert worden war, in den Spuren G-I verwendet, während dasselbe Antiserum, das mit dem obengenannten sis-verwandten Polypeptid vorinkubiert worden war, in den Spuren J-L verwendet wurde. Die Immunreaktion (das Binden) zwischen den oligoklonalen Rezeptoren und den Proteinen wurde, wie für die Figur 6 beschrieben, sichtbar gemacht. Die Positionen der in den Urinkonzentraten nachgewiesenen sis- und fes-verwandten Proteine sind jeweils am linken und rechten Rand durch die Marker "sis" bzw. "fes" angegeben.

Die Figur 10 ist eine Fotographie einer Autoradiographie, welche einen immunologischen Assay auf das Vorhandensein von ras-verwandten Proteinen im Urin erläutert.

Der Urin wurde 250fach (Spuren A und B), 35fach (Spur C), 70fach (Spur D), 75fach (Spur E) und 325fach (Spur F) konzentriert. Der Urin wurde dialysiert, 20 Mikroliter eines jeden Konzentrates wurden einer Elektrophorese unterzogen, und die Proteine darin wurden wie vorstehend beschrieben auf Nitrozellulose transferiert.

Die Spender wurden als normal (A, B und F) oder als einen der folgenden Zustände aufweisend diagnostiziert: 38 Wochen schwanger (Spur C), Lymphom (Spur D) und Colonkarzinom (Spur E). Derselbe normale Patient stellte die Urinproben bereit, die 14 Tage von einander getrennt gesammelt und in den Spuren A, B und F verwendet wurden.

Alle Urinproben wurden getestet unter Verwendung von 10 Mikrolitem Anti-ras-Aszitesflüssigkeit, induziert durch die Reste 96-118 von p21ras (Polypeptid 142), welche mit den Resten 744-759 des Polypeptids fesST (Spur A), den Resten 96-118 des Polypeptids rasHa (Spur B) oder den Resten 138-154 des Polypeptids v-sis (Spuren C-F) vorihkubiert worden waren. Die Immunreaktion (das Binden) zwischen den oligoklonalen Rezeptoren und den Proteinen wurde, wie für die Figur 6 beschrieben, sichtbar gemacht. Die Position der ras- verwandten Proteine, die in den Urinkonzentraten nachgewiesen wurden, sind am linken Rand durch den Marker "ras" kenntlich gemacht.

Das nachgewiesene Protein, welches mit dem Onkogen ras verwandt ist, wird durch einen monoklonalen Antikörper nachgewiesen, sezerniert durch das als ATCC Nr. HB 8 679 bezeichnete Hybridom, welches gegen das ras-verwandte Polypeptid 142 erzeugt worden war. Dieses Protein von etwa 55 kD wurde in der Spur A nachgewiesen, und die Aktivität wurde durch eine Vorihkubation mit dem immunisierenden Peptid (Spur B) blockiert. Aus demselben normalen Individuum gewonnener Urin enthielt zwei Wochen später dasselbe Protein (Spur F). Dieses Protein wurde in dem Urin einer schwangeren Patientin (Spur C) und eines Krebspatienten (Spur D und E) nachgewiesen.

Die Figur 11 ist eine Fotographie einer Autoradiographie, welche einen immunologischen Assay für das Vorhandensein eines 23 kD großen Proteins in drei Zellinien unter Verwendung eines Western-Blot-Verfahrens zeigt. Die Spuren der Figur enthielten jeweils einen Extrakt von etwa 10&sup6; Zellen pro Spur aus einer Nerz-Lungenzellinie, transformiert durch den Snyder- Theilen-Stamm von Nerz-Lungenlinien-Sarkomvirus-(MSTF)-Zellen (Spuren A-F), oder aus der uninfizierten MSTF-Zellinie CCL64 (Spuren G-L). Die jeweiligen Zellextrakte wurden von dem Polyacrylamidgel auf Nitrozelluloseblätter überführt, folgend einem Western-Blot- Verfahren.

Die Extrakte wurden unter Verwendung von gegen das Polypeptid 142, welches den Resten 96-118 von p21ras entspricht ("ras-1", Spuren A, B, G, H), erzeugten Antiseren, die mit dem Polypeptid 141, entsprechend den Resten 5-16 von v-rasHa ("ras-2", Spuren A, G) oder mit dem Polypeptid 142, entsprechend den Resten 96-118 von p21ras ("ras-1", Spuren B, H), vorinkubiert worden waren, getestet.

Dieselben Zellextrakte wurden mit Antiseren getestet, die erzeugt worden waren gegen das Polypeptid 121, entsprechend den Resten 519-530 von p85-fes ("fes-1", Spuren C, D, I, J) oder den Resten 744-759 von p85-fes ("fes-2", Spuren E, F, K, L). Die Antiseren wurden mit demfes-1-Polypeptid (Spuren D, J), mit fes-2-Polypeptid 744-759 (Spuren F, L) oder mit dem ras-1-Polypeptid (Spuren C, E, I, K) vorinkubiert, bevor sie mit den transferierten Zellextrakten zur Immunreaktion gebracht wurden. Die Proteine wurden wie für die Figur 6 beschrieben, sichtbar gemacht.

Die Figur 12 ist eine Fotographie einer Autoradiographie, welche einen immunologischen Assay für das Vorhandensein eines sezernierten Proteins in den Überständen der spontan transformierten Maus-3T3-Zellinie TRD-1 (Spuren A, B) oder einer humanen Blasenkarzinomlinie T-24 (Spuren C, D) erläutert. Die Überstände wurden auf das Vorhandensein sezernierten fes-verwandten Proteins getestet.

Die Zellinien wurden in Abwesenheit von Serum herangezogen und nach 48 Stunden des Wachstums abgesammelt. 35 Mikroliter einer Konzentration des Überstandes der T-24-Zellinie von 1500:1 oder einer Konzentration von 1000:1 der TRD- 1-Zellen wurden in einem Polyacrylamidgel einer Elektrophorese unterzogen und dann auf Nitrozellulose transferiert.

Mäuseantiseren gegen synthetisches v-fesST-Polypeptid 127, den Resten 744-759 von p85fes entsprechend ("fes-2"), wurden für den Assay verwendet. Die Antiseren wurden mit dem synthetischen Polypeptid 121, welches den Resten 519-530 von v-fesST entspricht ("fes-1", Spuren A und B), oder mit dem fes-2-Polypeptid, welches verwendet wurde, um die Antiseren zu erzeugen, (Spuren 13 und D) vorinkubiert.

Die Antiseren wurden dann mit dem transferierten Zellüberstand zur Immunreaktion gebracht. Die Proteine wurden wie für die Figur 6 beschrieben sichtbar gemacht.

Die Figur 13 ist eine Fotographie einer Autoradiographie, welche einen immunologischen Assay für das Vorhandensein eines ras-verwandten Proteins in einem Zellextrakt unter Verwendung eines Western-Blot-Verfahrens erläutert.

Ein Zellextrakt von etwa 10 spontan transformierten Mäuse-3T3-Zellen wurde in den Spuren A-D verwendet. 35 Mikroliter einer 1 500-fachen Konzentration von 48h-Überständen von Mäuse-3T3-TRD-1-Zellen wurde in den Spuren E-H verwendet. Die Proteine der Überstände wurden einer Elektrophorese in einem Polyacrylamidgel unterzogen und dann auf Nitrozellulose transferiert.

Oligoklonale Antikörper enthaltende Antiseren gegen das Polypeptid 142, entsprechend den Resten 98-118 von v-rasHa, wurden mit einem nicht-verwandten fes-Polypeptid vorinkubiert (Spuren A, C, E, G) oder mit dem ras-Polypeptid, welches für die Immunisierungen verwendet wurde (Spuren B, D F, H). Die Proteine wurden wie in der Figur 6 beschrieben sichtbar gemacht.

Die Figur 14 ist eine Fotographie einer Autoradiographie, welche einen immunologischen Assay für das Vorhandensein von ras-, sis- oderfes-verwandten Proteinen in einem Zellextrakt unter Verwendung eines Western-Blot-Verfahrens zeigt. Die Spuren der Figur enthalten jeweils einen Extrakt von etwa 10&sup6; Zellen von Nerz-Lungenzellen, transformiert mit dem Snyder-Theilen-Stamm des felinen Sarkomvirus (MSTF-Zellen), pro Spur.

Die Extrakte wurden unter Verwendung von Antiseren getestet, erzeugt gegen die Polypeptide, welche den Resten 96-118 von p21ras (Polypeptid 142, Spur 2), den Resten 1-18 von PDGF-2 (Polypeptid 112, Spur 1) und den Resten 744-759 von v-fes (Polypeptid 127, Spur 3) entsprechen. Die Proteine wurden wie für die Figur 6 beschrieben sichtbar gemacht.

Die Figur 15 ist eine Fotographie einer Autoradiographie, welche einen immunologischen Assay für das Vorhandensein einer Vielzahl von Proteinen, codiert von oder verwandt mit den Onkogenen sis, fes und ras, im Urin unter Verwendung eines Western-Blot-Verfahrens, ähnlich zu dem hierin zuvor beschriebenen, erläutert. Die flüssige Körperprobe in diesem Assay war Urinkonzentrat, erhalten, wie im Materialien- und Methodenteil beschrieben. Der konzentrierte Urin wurde in einem 5-17-prozentigen Polyacrylamidgel einer Elektrophorese unterzogen und dann elektrophoretisch auf Nitrozellulose gebracht.

Der Urin von acht Spendern wurde 40-fach konzentriert, dialysiert und 25 Mikroliter (das Äquivalent von 1 ml unkonzentrierten Urins) wurden elektrophoretisch behandelt, und die Proteine darin wurden, wie zuvor beschrieben, auf Nitrozellulose transferiert. Diese Spender wiesen multiple Myelome (Spur 1, Bilddarstellung A und B), Magenkrebs (Spur 2, Bilddarstellung A und B, Spur 1, Bilddarstellung C und D), 35 Wochen Schwangerschaft (Spur 3, Bilddarstellung A und B), Lymphom (Spur 4, Bilddarstellung A und B), Magenkrebs (Spur 1, Bilddarstellung C und D), 36 Wochen Schwangerschaft (Spur 2, Bilddarstellung C und D), Brustkrebs (Spur 3, Bilddarstellung C und D), 39 Wochen Schwangerschaft (Spur 4, Bilddarstellung C und D) und Brustkrebs (Bilddarstellung E) auf.

Monoklonale oder oligoklonale, Rezeptor enthaltende Antiseren, induziert durch sis- (Bilddarstellung A und B), ras- (Bilddarstellung C und D) oder fes-verwandte Polypeptide (Bilddarstellung E) wurden zur Sondierung jeder Probe verwendet, um sie auf immunisierende Peptide hin zu testen. Zwanzig Mikroliter Aszitesflüssigkeit (induziert durch das Hybridom ATCC HB 8679 und hier nachstehend beschrieben, und induziert durch ein Hybridom, das gegen das sis-verwandte Polypeptid 112, in der Sequenz den Positionen 1 - 18 von PDGF-2 entsprechend, herangezogen wurde; Buddarstellungsfelder C und D, bzw. A und B) oder Mäuseplasma (herangezogen gegen ein Polypeptid, welches der Sequenz des Onkoproteinsfes an den Positionen 744-759 entspricht, Bilddarstellung E), wurden 30 Minuten lang bei 37ºC mit 100 Mikrogramm des immunisierenden ras-Polypeptids 142 (Felder A, D und Spur 2 von Bilddarstellung E), sis-Polypeptids 112 (Bilddarstellung B und C) oder fes-Polypeptids (Bilddarstellung E, Spur 3), mit dem Polypeptid 171, das den Positionen 366-381, codiert von erbB, entspricht, (Bilddarstellung E, Spur 3) oder mit dem Polypeptid 312, den Positionen 590-605 von abl entsprechend (Bilddarstellung E, Spur 4), vorinkubiert.

-Der Vorinkubation folgend, wurden die Proben 1 zu 1000 in 3 Prozent BSA, 0,1 Prozent Triton X-100 in PBS bei einem pH-Wert von 7,4, verdünnt. Die Antiseren wurden dann, wie hierin vorstehend beschrieben, getestet. Die Bindung wurde wie in der Figur 6 beschrieben sichtbar gemacht.

Die Figur 16 ist eine Fotographie einer Autoradiographie, welche einen immunologischen Assay für das Vorhandensein der ras-, sis undfes-verwandten Proteine im Urin darstellt.

Der Urin wurde in monatlichen Intervallen von einem Spender bei dem zuvor diagnostiziert worden war, daß er aktiven Brustkrebs hat, gesammelt (Spur 1, 4, 7, 2, 5, 8, 3, 6, 9, Bilddarstellung A). Der Urin wurde konzentriert und dialysiert und ein Äquivalent von 1 ml unkonzentrierten Urins wurde aufjede Spur von Bilddarstellung A aufgetragen.

In Bilddarstellung B wurden Aliquots derselben Probe, die in Bilddarstellung A, Spuren 3, 6 oder 9 verwendet worden war, bei den folgenden Äquivalente unkonzentrierten Urins aufgetragen: 1000 Mikroliter (Spur 1), 500 Mikroliter (Spur 2), 250 Mikroliter (Spur 3), 125 Mikroliter (Spur 4), 60 Mikroliter (Spur 5), 30 Mikroliter (Spur 6), 15 Mikroliter (Spur 7), 7,5 Mikroliter (Spur 8).

Die Proben wurden vorpariert und mit oligoklonalen Antiseren gegen ras- (Positionen 96-118, Polypeptid 142, Bilddarstellung A, Spur 1-3, Bilddarstellung B), fes- (Positionen 744-759, Polypeptid 127, Bilddarstellung A, Spuren 4-6) oder sis-Polypeptid (PDGF-2, Positionen 1-18, Polypeptid 112, Bilddarstellung A, Spuren 7-9) sondiert, wie für die Figur 15 beschrieben, außer daß keine Vorinkubation mit synthetischen Peptiden durchgeführt wurde.

Die Figur 17 ist eine Fotographie einer Autoradiographie, welche einen immunologischen Assay für das Vorhandensein von ras- und fes-verwandten Proteinen im Urin darstellt. Bei den Spendern der getesteten Urinproben wurde diagnostiziert, daß sie wiederauftretenden Brustkrebs (Spuren 1, 2) hatten oder daß sie normale Individuen waren (Spuren 3-8).

Der Assay auf ras-verwandte Proteine (Bilddarstellungsfeld A) und fts-verwandte Proteine (Bilddarstellung B) wurde, wie für die Figur 16 beschrieben, durchgeführt. Die getesteten Proben waren der Urin von einem Patienten mit einer vorübergehenden klinischen Besserung bei Brustkrebs (Spur 1), desselben Patienten 3 Wochen später, als der Brustkrebs wieder auftrat (Spur 2), und einer normalen Frau (Spuren 3-5), wobei die Proben 3 Tage auseinanderliegend gesammelt wurden, einer normalen Frau, wobei die Proben 12 Stunden auseinanderliegend gesammelt wurden (Spuren 6-7), und eines normalen Mannes (Spur 8).

Die Figur 18 ist eine Fotographie einer Autoradiographie, welche den Nachweis von ras-, fes- und sis-verwandten Proteinen in den Urinproben von Spendern mit Krebs zeigt. Der Urin von Spendern mit Blasenkrebs (Spur 1), Prostatakrebs (Spur 2), Prostataknötchen (Spur 3) oder einem Lymphom (Spur 4) wurde vorbereitet und mit Antiseren gegen sis (Bilddarstellung A), ras (Bilddarstellung B) oderfrs (Bilddarstellung C) wie in der Figur 16 beschrieben, sondiert. Die Banden, die in den Spuren 1, 2 etwas langsamer als ps6sis migrieren, repräsentieren überschüssige Mengen von Albumin in diesen Proben. Obwohl die erhöhten Spiegel von ps6sis, p31sis und p25sis mit den erhöhten Albuminspiegeln in Bilddarstellung A, Spuren 1,2 korrelieren, enthielten andere Urinproben von Spendern mit Blasen- oder mit Prostatakrebs erhöhte Spiegel von sis-verwandten Proteinen in Abwesenheit von erhöhten Albuminspiegeln (Daten nicht gezeigt). Die am langsamsten migrierenden Banden in Bilddarstellung B, Spuren 1-3, kennzeichnen p100ras, während die Banden, die etwas schneller als die leichte Kette in Bilddarstellung B, Spuren 1-4, sind, p21ras kennzeichnen.

Die Figur 19 ist eine Fotographie einer Autoradiographie, welche den Nachweis von Onkogenverwandten Proteinen in dem Urin einer schwangeren Spenderin darstellt.

Vier Urinproben von demselben Individuum, gesammelt in einwöchigen Intervallen während des letzten Monats der Schwangerschaft, wurden mit Antiseren gegen sis-verwandtes Polypeptid 112 (PDGF-2, Positionen 1-18, Bilddarstellung A), ras-Polypeptid 142 (Positionen 96-118, Bilddarstellung B) oder fes-Polypeptid 127 (Positionen 744-759, Bilddarstellung C) sondiert. Eine Uberexposition von Buddarstellung C zeigt das Vorhandensein von p35 (Spuren 3 und 4) und p40fes (Spur 4). Das etwas schneller als die Bande der leichten Kette (Bilddarstellung C, Spuren 1-4) oder am unteren Ende des Gels (Bilddarstellung C, Spuren 2- 4) wandernde Protein wurde mit den Mäuseantiseren gegen das fes-Peptid nachgewiesen. Darüber hinaus wurde ebenfalls ein Protein von 150 000 Dalton mit den Mäuseantiseren gegen dasfes-Peptid nachgewiesen. Urinproben wurden in einwöchigen Intervallen gesammelt.

Die Figuren 20, 21 und 22 sind Tabellen, welche die Aminosäuresequenzen von drei konservierten Bereichen der Onkoproteine, die eine Proteinkinaseaktivität haben, zeigen. Diese Bereiche werden als "KONSERVIERTER KINASEBEREICH" 1, 2 bzw. 3 in den Figuren 20, 21 bzw. 22 bezeichnet. Das für ein Onkoprotein mit einer Proteinkinaseaktivität codierende Onkogen wird durch sein übliches Symbol in der linken Spalte bezeichnet. Die mittlere Spalte kennzeichnet den Ort der konservierten Aminosaurerest-Sequenz in der Polypeptidsequenz des Onkoproteins vom Aminoende aus. Die rechte Spalte zeigt die Aminosäurerest-Sequenzen von diesen konservierten Bereichen von links nach rechts und in der Richtung vom Aminoende hin zum Carboxyende. Die Aminosäurerest-Sequenzen sind ebenfalls die Sequenzen der Polypeptide, die nützlich als Immunogene für die Induktion der Produktion monoklonaler Rezeptoren sind.

Die Figur 23 ist eine Tabelle, welche die Häufigkeit des Nachweises onkogenverwandter Proteine in Urinproben von 51 Kontrollspendern (normale Spender) und 189 Urinproben von Spendern mit einer Vielfalt von bösartigen Erkrankungen zeigt. Die Menge der Onkogenverwandten Proteine in dem Urin wurde unter Verwendung von Immunblots abgeschätzt und in eine von vier Kategorien eingeteilt: nicht detektierbar, detektierbar, 5- bis 15fach erhöht und mehr als 15fach erhöht. Die verbleibenden Typen sind als Verbund aufgelistet.

p21ras wurde in etwa 70 Prozent aller Proben von Spendern mit einer neoplastischen Tumorerkrankung nachgewiesen. Es wurden jedoch ähnliche Häufigkeiten in offensichtlich normalen Individuen gefünden Die auffälligste Erhöhung von p21ras wurde in Proben von Spendern mit Eierstock- und Magenkrebs gefünden, sowie bei Myelom und Fehlgeburt-Schwangerschaften (molar pregnancies), von denen alle mehr als 15fache Erhöhungen dieses Proteins in wenigstens 30 Prozent der Proben aufwiesen.

Die Figur 24 ist eine Tabelle von Daten, welche den Nachweis verschiedener Spiegel der Onkogen-verwandten Proteine in 260 Urinproben von schwangeren Spenderinnen widerspiegelt. Die Proben wurden gemäß dem Trimester der Schwangerschaft gruppiert. Mehrfache Urinsammlungen wurden von vielen der Spenderinnen erhalten. Die Assays wurden in Übereinstimmung mit den Verfahren und Methoden, die hier nachstehend in dem Materialien- und Methodenteil dargestellt sind, durchgeführt. Wie bei der Untergruppe von Spendern mit Brustkrebs, hier nachstehend erörtert, wurden sehr hohe Spiegel von pssras in einer Gruppe von schwangeren Spenderinnen im gesamten Verlauf der Schwangerschaft nachgewiesen. sis- und fes-verwandte Proteine erhöhten sich mit dem Fortschreiten der Schwangerschaft.

Die Spiegel von p55ras veränderten sich im Verlauf einiger der Schwangerschaften in dramatischer Weise. Im Gegensatz zu den Spiegeln von pssras, die in mehrfachen Proben von normalen und von Spendern mit Brustkrebs nachgewiesen worden waren, erhöhten sich die Konzentrationen von ras-verwandten Proteinen in bestimmten Spendern mehr als 15fach innerhalb einer Woche.

Die Konzentration der drei sis-verwandten Proteine war den letzten Monat der Schwangerschaft hindurch etwa dieselbe. p35fes wurde in den letzten zwei Wochen der Schwangerschaft nachgewiesen, wänrend p40fes nur in der letzten Woche nachgewiesen wurde.

Urinproben, die sechs Wochen nach der Entbindung genommen wurden, enthielten weiterhin erhöhte Konzentrationen dieser sis-verwandten Proteine, obwohl die ras- und fes-verwandten Proteine zum Normalen zurückkehrten (Daten nicht gezeigt).

Die Figur 25 zeigt einen Immunoblot von durch fes transformierten Nerzlungenzellen. Ein Nerzzellextrakt wurde mit verschiedenen Antikörpern gegenfes (Spuren A-1) oder gegen erbB (Spuren J, K) sondiert.

Die Figur 26 zeigt einen Immunoblot humaner epidermoider Karzinomzellen. Ein Extrakt einer humanen epidermoiden Karzinomzellinie wurde mit Antikörpern, wie sie in der Figur 1 verwendet wurden, sondiert.

Die Figur 27 zeigt einen Immunoblot einer konzentrierten Urinprobe von einer schwangeren Diabetespatientin. Eine konzentrierte Urinprobe von einer schwangeren Diabetespatientin wurde mit Antikörpern, wie sie in der Figur 1 verwendet wurden, sondiert.

Die Figur 28 zeigt einen Immunoblot eines Extraktes eines endometrialen Tumors. Ein Extrakt eines endometrialen Tumors (NIH-Zugangsnummer 071-781 473-1) wurde mit Antikörpern gegen fes (Spuren A-H) oder erbB (Spuren I-L) sondiert. Die Antikörper in den Spuren A-D ergeben Reaktivitätsmuster in ELISA-Assays, die ver3chieden sind von denjcnigen in den Spuren E-H. Die Spuren I und J sind gegen die Domänen von v-erbB gerichtet, und die Spuren K und L erzeugen ein davon verschiedenes Reaktivitätsmuster gegen dasselbe Onkoprotein.

Die Figur 29 zeigt einen Immunoblot eines Extraktes eines Brusttumors. Ein Extrakt eines Brusttumors (NIH-Zugangsnummer 121-960-1), welcher in den Lymphknoten metastasierte, wurde mit Antikörpern, wie sie in der Figur 4 verwendet wurden, sondiert.

Die Figur 30 zeigt einen Immunoblot eines Brusttumors (NIH-Zugangsnummer 31-14 459), von dem ein Extrakt mit Antikörpern, die in der Figur 4 verwendet wurden, sondiert wurde.

Die Figur 31 zeigt einen Immunoblot eines Eierstocktumors (NIH-Zugangsnummer 31- 13 530), von dem ein Extrakt mit den Antikörpern, wie sie in der Figur 4 verwendet wurden, sondiert wurde.

Die Figur 32 zeigt einen Immunblot eines Brusttumors (NIH-Zugangsnummer 121-960-1), welcher in einen Lymphknoten metastasierte. Dieser Extrakt des metastasierenden Brusttumors wurde mit Antikörpern gegen ros (Spur A), fes (Spur B), β-TGF(Spuren C-G), ras (Spuren H- J) und erbB (Spuren K-N) sondiert.

Die Figur 33 zeigt einen Immunblot eines Extraktes eines metastasierenden Eierstockkarzinoms, abgeleitet von dem NIH-Tumor 31-18265. Dieses Karzinom metastasierte zum Omentum und wurde mit den Antikörpern, wie sie in der Figur 8 verwendet wurden, sondiert.

Die Figur 34 zeigt einen Immunblot eines metastasierenden Colonkarzinoms (NIH-Zugangsnummer 31-18152), welches in den Lymphknoten metastasierte. Dieser Extrakt wurde mit den Antikörpern, wie sie in der Figur 8 verwendet wurden, sondiert.

Die Figur 35 zeigt einen Immunblot eines metastasierenden Eierstockkarzinoms (NIH- Zugangsnummer 031-10128-1). Dieser Extrakt eines Eierstockkarzinoms, welches zum Omentum metastasierte, wurde mit den Antikörpern, wie sie in der Figur 8 verwendet wurden, sondiert.

Die Figur 36 zeigt einen Immunblot eines Lymphoms (NIH-Zugangsnummer 021-50073-1) aus der Milz. Dieser Extrakt wurde mit den Antikörpern, wie sie in der Figur 8 verwendet wurden, sondiert.

Die Figur 37 zeigt einen Immunblot eines Brustkarzinoms (NIH-Zugangsnummer 031-1239- 1). Dieser Extrakt wurde mit den Antikörpern, wie sie in der Figur 8 verwendet wurden, sondiert.

Die Figur 38 zeigt einen Immunblot eines Extraktes eines rektalen Tumors (NIH-Zugangsnummer 31-19066). Dieser Extrakt wurde mit den Antikörpern, wie sie in der Figur 8 verwendet wurden, sondiert.

Die Figur 39 zeigt einen Immunblot eines metastasierenden Lungenkarzinoms (NIH-Zugangsnummer 041-78297-1). Ein Extrakt dieses Lungenkarzinoms, welches zu einem Lymphknoten metastasierte, wurde mit den Antikörpern, wie sie in der Figur 8 verwendet wurden, sondiert.

Die Figur 40 zeigt einen Immunblot eines Striatums der Ratte. Ein Extrakt vom Striatum der Ratte, entnommen aus einem 18 Tage alten Embryo und aus 2 Tage alten, 18 Tage alten, 70 Tage alten und 1 Jahr alten Ratten, wurde mit H/N-R4S (Spur A), H-RAS (Spur B), MYC (Spur C), v-myb (Spur D), int-1 (Spur E) und zwei unterschiedlichen, gegen SIS gerichteten Antikörpern (Spuren F und G) sondiert.

Die Figuren 41 und 42 sind Tabellen, welche die Reaktivitätsmuster von Tumorextrakten, abgeleitet von Zellinien, die im Depot des NIH hinterlegt sind, zeigen. Die Extrakte wurden mit verschiedenen Antikörpern sondiert, und die sich ergebenden Muster wurden nach dem Vorhandensein und dem Spiegel des Onkogenproduktes eingestuft. Die Einstufüng beruhte auf den Intensitäten der Banden, abgeleitet unter Verwendung der Immunoblot-Technik.

Die Figur 43 zeigt das asynchrone Auftreten von onkogen-verwandtem Protein im Urin eines Patienten mit einer Schwangerschafts-Trophoblastenerkrankung, welcher sich einer Chemotherapie unterzog. Aufeinanderfolgende Urinproben eines Patienten mit einer Schwangerschafts-Trophoblastenerkrankung, welcher sich einer Chemotherapie unterzog, wurden mit Antikörpern, die gegen SIS-Reste (Spur A), H/N-RAS-Reste (Spur C), MYC-Reste (Spuren D und E), src-Reste (Spur F und G) und int-1-Reste (Spur H) gerichtet waren, sondiert.

Detaillierte Beschreibung der Erfindung

Häufig hierin verwendete Begriffe werden wie folgt definiert:

Rezeptor - Ein "Rezeptor" ist ein biologisch aktives Molekül, das an einen Liganden bindet. Die Rezeptormoleküle dieser Erfindung sind intakte oder im wesentlichen intakte Antikörper oder den Idiotyp enthaltende Polypeptidanteile von Antikörpern. Die biologische Aktivität eines Rezeptormoleküls wird durch das Binden des Rezeptors an seinen antigenen Liganden nach ihrer Mischung in einem waßrigen Medium wenigstens bei physiologischen pH-Werten und lonenstärken, bewiesen. Bevorzugtermaßen binden die Rezeptoren ebenfalls an den antigenen Liganden innerhalb eines pH-Wertbereichs von etwa 5 bis etwa 9 und bei lonenstärken, wie der von destilliertem Wasser bis zu der von etwa einmolarem Natriumchlorid.

Den Idiotyp enthaltende Polypeptidanteile (Antikörperverbindungsstellen) von Antikörpern sind diejenigen Anteile der Antikörpermoleküle, die den Idiotyp einschließen und an den Liganden binden, und schließen die Fab und F(ab')&sub2;-Anteile der Antikörper ein, die im Fachbereich wohlbekannt sind und die durch die Reaktion von Papain bzw. Pepsin mit den im wesentlichen intakten Antikörpern durch Verfahren, die gut bekannt sind, hergestellt werden. Siehe zum Beispiel das US-Patent Nr.4 342 566 von Theofilopolous und Dixon. Intakte Antikörper werden bevorzugt und werden verwendet, um die Rezeptormoleküle, die durch diese Erfindung in Betracht gezogen werden, zu erklären.

Monoklonaler Rezeptor - Ein "monoklonaler Rezeptor" (Mab) ist ein Rezeptor, dei durch Klone einer einzelnen Zelle, die als ein Hybridom bezeichnet wird, welches lediglich eine Art eines Rezeptormoleküls sezerniert, erzeugt wird. Die Hybridomzelle wird aus einer antikörpererzeugenden Zelle und einem Myelom oder einer anderen sich selbst beständig propagierenden Zellinie füsioniert. Solche Rezeptoren wurden zuerst von Kohler und Milstein, Nature 256: 495-497 (1975), beschrieben, wobei diese Beschreibung durch den Bezug darauf einbezogen ist.

Oligoklonaler Rezeptor - Ein "oligoklonaler Rezeptor" ist ein Rezeptor, der durch mehr als ein Epitop auf einem Polypeptid von mittlerer Länge, wie etwa 7 bis etwa 40 oder weiter bevorzugt etwa 10 bis etwa 30 Aminosäurereste Länge, induziert ist und daran bindet. Oligoklonale Rezeptoren sind gewöhnlich eine Mischung von Rezeptoren, die von mehr als einer Zelle erzeugt werden. So erzeugte oligoklonale Rezeptoren sind gewöhnlich bezüglich dee Epitope spezifischer in ihrer Bindung als die polyklonalen Rezeptoren, die gegen ganze Proteinmoleküle erzeugt werden, welche Epitopbereiche über die ganze Länge der Proteinkette oder -ketten aufweisen können. Mit den hierin nützlichen Polypeptiden immunisierte Tiere erzeugen Seren, welche oligoklonale Rezeptoren (Antikörper) enthalten.

Ligand - Ein "Ligand" ist das Protein oder das Polypeptid, an welches ein Rezeptor dieser Erfindung bindet.

Entspricht - Der Begriff "entspricht", wie er hierin im Zusammenhang mit Aminosäurerest- Sequenzen verwendet wird, bedeutet, daß die Aminosaurerest-Sequenz eines ersten Polypeptids oder Proteins in hinreichender Weise ähnlich ist zu der Aminosäurerest-Sequenz, die in einem zweiten Polypeptid oder Protein enthalten ist, so daß Rezeptoren, die gegen das erste erzeugt werden (z.B. ein antigenes synthetisches Polypeptid) in immunologischer Weise an das zweite binden (z.B. ein Onkoprotein), wenn die beiden in einer wäßrigen Zusammensetzung yermischt werden. Solche entsprechenden Polypeptide und/oder Proteine, so kann man sagen, enthalten homologe Epitope und haben daher homologe Sequenzen von wenigstens etwa 6 bis etwa 8, z.B. 7 Resten, gemeinsam.

Die das Epitop enthaltenden Aminosäurerest-Sequenzen des entsprechenden ersten und zweiten Polypeptids oder Proteins sind am meisten bevorzugt identisch. Austausche jedoch, bevorzugtermaßen konservative, von den Aminosäureresten und Deletionen oder Additionen von Resten innerhalb des Epitops können gemacht werden und immer noch die Kreuzreaktion eines Rezeptors für das erste Polypeptid oder Protein mit dem zweiten gestatten, wie es bekannt ist. Konservative Austausche der Aminosäurereste sind gut bekannt und schließen Austausche der Reste zwischen Lysin (Lys, K) und Arginin (Arg, R), zwischen Asparaginsaure (Asp, D) und Glutaminsäure (Glu, E), zwischen Leucin (Leu, L) und Isoleucin (Ile, 1) und dergleichen ein.

Die bevorzugten Polypeptide, die hierin nützlich sind, werden häufig so beschrieben, daß sie eine Aminosäurerest-Sequenz haben, welche einem Teil der Aminosäurerest-Sequenz eines Proteins entspricht. Solche Polypeptide enthalten bevorzugtermaßen nur Aminosäurerest- Sequenzen, die in identischer Weise entsprechend sind, zusätzlich zu terminalen Resten, wie Cys-Resten, die für die Bindung oder Verknüpfüng des Polypeptids an einen Träger verwendet werden. Zusätzliche Aminosäurereste, die nicht den Resten in dem Protein entsprechen, können ebenfalls an den Enden des Polypeptids vorhanden sein, aber die Verwendung solcher Reste, wenngleich sie hierin ins Auge gefaßt wird, ist gewöhnlich unrentabel und wird nicht bevorzugt.

In entsprechender Weise werden Proteine als eine Aminosäurerest-Sequenz besitzend beschrieben, wobei die Aminosäurerest-Sequenz eines Polypeptids einem Abschnitt derselben entspricht. Diese Terminologie hat die Absicht, dieselbe Beziehung zwischen dem Polypeptid und dem Protein, die hierin vorstehend besprochen wurde, zu implizieren.

-Die vollständigen Bezeichnungen für die einzelnen Aminosäurereste werden hierin manchmal ebenso verwendet, wie die gut bekannten Abkürzungen aus drei Buchstaben. Am häufigsten werden die Symbole aus einem Buchstaben für die Aminosaurereste verwendet. Die nachstehende Tabelle der Entsprechungen stellt den vollständigen Namen, wie auch die Abkürzungen und die Symbole für einen jeden hierin genannten Aminosäurerest, bereit. Entsprechungstabelle

Entsprechungstabelle

(A. L. Lehninger, Biochemistry, Worth Publishers, Inc., N.Y., N.Y., 1970).

I Herstellung monoklonaler Rezeptoren

Wie zuvor bemerkt wurde, verwendet ein Verfahren der vorliegenden Erfindung monoklonale Rezeptormoleküle, welche an ein immunogenes Polypeptid mittlerer Länge, z.B. etwa 7 bis etwa 40 Reste und bevorzugtermaßen etwa 10 bis etwa 30 Reste, binden, wobei sie ebenfalls an einen Proteinmolekülliganden binden, von dessen Aminosäurerest-Sequenz ein Teil mit der Aminosaurerest-Sequenz dieses Polypeptids übereinstimmt. Solche monoklonalen Rezeptoren werden erzeugt oder induziert durch die Verwendung eines immunogenen Polypeptids oder eines Konjugates dieses Polypeptids, verknüpft mit einem Träger, wobei das immunogene Polypeptid eine Aminosäurerest-Sequenz mittlerer Länge enthält, welche mit einem Protein der Aminosäurerest-Sequenz des Proteinmolekülliganden übereinstimmt.

Die Epitoplokalisierung monoklonaler Antikörper wirft technische Probleme auf Monoklonale Antikörper gegen ein gesamtes bakterielles Genprodukt können mit zwei unterschiedlichen Typen von Immunogenen, nativen oder denaturierten, hergestellt werden. Die Verwendung des nativen Proteins wirft die gewichtigstenn technischen Probleme bezüglich der Reinigung und nachfolgenden Epitopkartierung auf Der Hauptvorteil der Verwendung eines nativen Proteins ist die Herstellung monoklonaler Antikörper, welche die biologische Funktion des Zielproteins blockieren.

Ein in Bakterien hergestelltes Onkogenprodukt ist typischerweise strukturell nicht dasselbe wie das in höheren Organismen synthetisierte Genprodukt. Ein direkter Beweis für diesen Unterschied wird durch die Analyse des sis-Genproduktes bereitgestellt. In Säugerzellen wird das p28sis schnell zu p20sis gespalten. Im Gegensatz dazu wird bakterielles p28sis weder gespalten noch bildet es ein Dimer.

Ein indirekter Beweis für Unterschiede zwischen anderen Onkogenprodukten, die in Bakterien oder in Vogelzellen hergestellt werden, wird durch die Beobachtung bereitgestellt, daß monoklonale, gegen das in E. coli hergestellte Proteinprodukt erzeugte Antikörper, viel effizienter an das Immunogen binden als an das in transformierten Hühnerzellen synthetisierte Protein, obwohl das Immunogen sogar denaturiert war.

Man sieht, daß die Sequenz des viralen Onkogens eine Basis für die Identifizierung zusätzlicher Bereiche der Sequenz eines Protoonkogens bereitstellen kann, welche nützlich für die Synthese zusätzlicher Peptide zur Erzeugung und Isolation zusätzlicher monoklonaler Rezeptoren sind. In ännlicher Weise identifiziert die Sequenzanalyse dieser Protoonkogene zusätzliche verwandte Peptide, die noch nicht aus einem Retrovirus isoliert worden sind.

Daher können, obwohl die Reinigung des denaturierten Proteins technisch einfacher ist, die sich ergebenden Antiseren Konformationen erkennen, die einzig dem bakteriellen Genprodukt eigen sind. Diese Beobachtung wirft ernsthafte technische Schwierigkeiten für Untersuchungen zur Epitopkartierung auf.

Vorgehensweisen, um das Epitop der Antikörper zu definieren, verwenden durch partielle Proteolyse oder die Expression von subgenomischen Fragmenten erzeugte Proteinfragmente. -Obwohl die Kartierung von Epitopen unter Verwendung von Proteinftagmenten zuerst von Niman und Elder, Proc. Natl. Acad. Sci USA 77: 4 524 (1980) gezeigt worden ist, konnte lediglich eine Annäherung an die Bindungsstellen erwirkt werden, sogar dann, wenn verschiedene Verdaue mit einer großen Auswahl an monoklonalen Antikörpern getestet wurden. Daher limitiert sogar eine Immunisierung mit Proteinftagmenten die Definition der Bindungsstelle. Darüber hinaus gibt es keine Garantie dafür, daß die Bereiche von Interesse monoklonale Antikörper induzieren werden.

Im Gegensatz dazu gewährleistet eine Immunisierung mit geeigneten Polypeptiden einer bekannten Aminosäurerest-Sequenz, wie hierin beschrieben, eine Erzeugung von Antikörpern (Rezeptoren), die mit wohldeflnierten Bereichen eine Immunreaktion eingehen, d.h., Bereichen, die den Sequenzen der immunisierenden Polypeptide entsprechen.

Die Kartierung von Epitopen legt nahe, daß die Veränderung des Epitops durch eine Aminosäure merklich abweichende Reaktivitäten erzeugen kann, während andere Untersuchungen zeigen, daß Kreuzreaktivitäten erhalten werden, wenn eine oder mehrere Aminosäuren innerhalb des Epitops unterschiedlich sind. Darüber hinaus kann eine Immunisierung desselben Mäusestamms mit demselben synthetischen Polypeptid unterschiedliche im Serum nachgewiesene Reaktivitäten erzeugen

Die mit den synthetischen Polypeptiden erzeugten Hybridome stellen auch monoklonale Rezeptoren her, die mit dem intakten Protein unter einer Vielzahl von Reaktionsbedingungen reagieren, weil die Erkennung in weitem Maße unabhängig von der Konformation ist. Daher können Western-Blot, Dot-Blot, fixierte Zellen und fixierte Gewebe und Körperflüssigkeiten, wie zelluläre Extrakte, Amnionflüssigkeit und Urin, entweder konzentriert oder wie erhalten, ebenso wie native Proteine, getestet werden. Darüber hinaus gestatten die bekannten präzise definierten Aminosäurereste in dem Epitop die Isolation von Antikörpern, die einzelne Aminosäureaustausche unterscheiden können, welche dadurch ein Mittel zur Bestimmung der Signifikanz von begrenzten Austauschen in konservierten Bereichen verwandter Proteine bereitstellen.

Monoklonale Antikörper gegen synthetische Polypeptide stellen ebenfalls ein Mittel zur Kartierung von Stellen der Proteinwechselwirküng bereit. Von differentiellen Copräzipitationen von Molekülen, die mit pp60src assoziiert sind, wurde berichtet, was die Identifizierung von Bereichen der src-Proteine nahelegt, die an solchen Wechselwirkungen beteiligt sind.

Daher erfordert die Einleitung der Herstellung monoklonaler Antikörper (Rezeptoren) mit einem immunogenen synthetischen Polypeptid mit durch die Sequenz des immunisierenden Polypeptids definierten Domänen keine komplexen Verfahrensweisen für eine Isolation des entsprechenden immunogenen Onkoproteins oder zur Identifizierung der Epitopstelle dieses Onkoproteins und erzeugt Rezeptoren, welche das Onkogenprodukt in einer von der Konformation unabhängigen Weise erkennen, was alles die Anwendung solcher Rezeptoren für eine Vielfalt von Untersuchungen erweitert.

Es wurde zuvor bemerkt, daß man, obwohl gezeigt wurde, daß der Schutz des Wirtstiers durch die Verwendung der immunogenen Polypeptide als aktive Wirkstoffe in Impfstoffen möglich ist, bisher nicht dachte, daß die Fähigkeit, solche immunogenen Polypeptide zu verwenden, um hohe Erträge von Hybridomantikörpern (Mab's) zu erzeugen, eine wahrscheinliche Möglichkeit sei. Da jeder Mab aus einer einzelnen Zelle abgeleitet ist, welche nur eine Spezifität erzeugt, kann das Verhältnis der Anzahl von Klonen, die Anti-Polypeptid-Antikörper erzeugen, welche ebenfalls das intakte Proteinmolekül erkennen, zu der Gesamtzahl der das Polypeptid erkennenden Klone für eine vernünftige Abschätzung der tatsächlichen konformationellen Häufigkeit des Polypeptids sorgen.

Die hierin beschriebenen Ergebnisse stehen im Widerspruch zu dem zuvor erwähnten stochastischen Modell, und die Häufigkeit für die hierin verwendeten Polypeptide mittlerer Länge, eine Konformation ähnlich zu der des nativen Proteins einzunehmen, ist viel höher als zuvor erwartet wurde. Die Häufigkeit Hybridome herzustellen, deren Mab's sowohl das synthetische Polypeptid, gegen welches sie erzeugt worden sind, als auch das intakte Molekül erkennen, ist etwa 4 Größenordnungen (etwa 10000fach) größer, als von der stochastischen Theorie vorhergesagt wurde.

Es wird ebenfalls angemerkt, daß verschiedene Bearbeiter seit einigen Jahrzehnten immunogene Polypeptide verwendet haben, um Antikörper, die diese Polypeptide erkennen, zu erzeugen. Darüber hinaus wurde der oben als Referenz angeführte Artikel von Kohler und Milstein, was die Produktion monoklonaler Antikörper betrifft, 1975 publiziert. Seit diesem Datum, 1975, beschrieben Arnheiter et al Nature (London) 294: 278-280 (1981), einen Versuch, um einen monoklonalen Antikörper unter Verwendung eines Polypeptidimmunogens herzustellen. Wie zuvor angemerkt wurde, müssen die Ergebnisse von Arnheiter et al. insofern als ein Fehlschlag betrachtet werden, als daß diese Autoren die Verwendung der Milzen von drei immunisierten Mäusen benötigten und lediglich einen monoklonalen Antikörper vom IgG- Typ erhielten, welcher ihr großes 56-meres Polypeptid sowie das Protein, dessen Sequenz dieses Polypeptid entsprach, erkannte.

Man glaubt, daß die relative Armut an veröffentlichten Berichten, die sich auf die Erzeugung monoklonaler Rezeptoren beziehen, welche mit immunogenen Polypeptiden hergestellt werden, die sowohl das Immunogen als auch einen Proteinliganden, mit dessen Aminosäurerest-Sequenz das immunogene Polypeptid zum Teil übereinstimmt, erkennen, auf wenigstens zwei Faktoren zurückzuführen ist. Erstens besagt der vorherrschende Gedanke, der dem stochastischen Modell folgt, voraus, daß wenige von diesen monoklonalen Antikörpern, wenn überhaupt welche, erzeugt werden können. Zweitens: die Tatsache, daß Bearbeiter, wie Arnheiter et al., siehe oben, kein zur Herstellung monoklonaler Rezeptoren geeignetes Verfahren besaßen, insofern als die monoklonalen Rezeptoren dieser Erfindung, die gegen Polypeptide erzeugt werden, anders hergestellt werden als monoklonale Antikörper, die gegen ganze Proteine hergestellt werden.

Um monoklonale Rezeptoren der IgG-Klasse erfolgreich herzustellen, welche sowohl das immunogene Polypeptid als auch den Proteinliganden erkennen, dessen Aminosäurerest- Sequenz dieses Polypeptid zum Teil entspricht, sollte man daher den hierin nachstehend skizzierten Schritten folgen.

Ein immunogenes Polypeptid wird allein oder als ein Konjugat dieses Polypeptids, gebunden an (verknüpft mit) einen (einem) Träger, bereitgestellt. Das Polypeptid hat eine Aminosäurerest- Sequenz von mittlerer Länge, wie etwa 7 bis etwa 40 Aminosäurereste, und bevorzugtermaßen etwa 10 bis etwa 30 Reste. Die Aminosäurerest-Sequenz des immunogenen Polypeptids stimmt mit einem Teil der Aminosäurerest-Sequenz eines Proteinmolekülliganden, wie einem Onkoprotein überein. Während das immunogene Polypeptid an sich als ein Ligand verwendet werden kann, wird es bevorzugt, das Polypeptidimmunogen als ein Konjugat, gebunden an einen Träger, wie das Hämocyanin der Schüssellochnapfschnecke (KLH), Albumine wie Rinderserumalbumin (BSA), humanes Serumalbumin (HSA), rote Blutzellen, wie Schaferythrozyten, Tetanustoxoid und Edestin, sowie Polyaminosäuren, wie Poly(D-Lysin: D-Glutaminsäure), und dergleichen zu verwenden.

Die Immunogenität und Antigenität des Polypeptids kann durch das Binden des Polypeptids an einen Schlüssellochnapfschnecken-Hämocyanin-Träger als ein Konjugat und der anschließenden Verwendung des so hergestellten Konjugates zur Immunisierung einer Maus getestet werden. Das immunisierende Polypeptid oder Konjugat wird in einem physiologisch annehmbaren Lösungsmittel, wie normaler Kochsalzlösung, phosphatgepufferter Kochsalzlösung oder dergleichen, wie sie im Fachbereich gut bekannt sind, gelöst oder dispergiert. Ein nachstehend erörtertes Adjuvans ist ebenfalls in dem für die Immunisierungen verwendeten Inokulum eingeschlossen.

Ein nützliches Polypeptid ist in hinreichender Weise immunogen und antigen, um einen Bindungstiter von 50 Prozent des oligoklonalen Rezeptor enthaltenden Antiserums der immunisierten Maus an das Polypeptid zu erzeugen, das wenigstens etwa eine Verdünnung von 1:400 nach drei Immunisierungen in einem Zeitraum von einem Monat ist, wobei eine jede Immunisierung wenigstens etwa 10 Mikrogramm, und bevorzugtermaßen wenigstens etwa 50 Mikrogramm des Polypeptids in dem Konjugat enthält und komplettes Freundsches Adjuvans für die erste Immunisierung, und danach Alaun als Adjuvans verwendet wird.

Dieses Testverfahren muß nicht vor der Verwendung eines gegebenen Polypeptids als Immunogen ausgeführt werden, aber es ist zu bevorzugen, dieses so als eine Vorscreening- Technik durchzuführen, um zu bestimmen, ob diese Polypeptide nützlich für die Herstellung der erwünschten monoklonalen Rezeptoren sind. Die hierin als Immunogene nützlichen Polypeptide sorgen für den obengenannten Titer unter Verwendung des obengenannten Immunisierungsprotokolls, ob sie zum Vorscreenen verwendet werden oder nicht.

Nach der Bereitstellung des immunogenen Polypeptids wird ein Säuger, wie eine Maus, ein Kaninchen, eine Ziege, ein Pferd oder dergleichen, mit dem immunogenen Polypeptid oder einem Konjugat des Polypeptids, gebunden an einen Träger, hyperimmunisiert, um ein Hyperimmunserum bereitzustellen, dessen Rezeptormoleküle einen Soprozentigen Bindungstiter an das Polypeptid bei wenigstens einer Verdünnung von etwa 1:400 zeigen. Daher kann dasselbe Tier, z.B. eine Maus, in welcher man die Immunogenität des Polypeptids vorzutesten wünschen mag, verwendet werden, um die Mab's heranzuziehen.

Es wird insbesondere bevorzugt, daß dasselbe Tier, das für einen Vortest verwendet wird, für das Heranziehen der Mab's verwendet wird. Diese Präferenz rührt von der Tatsache her, daß die Herstellung von monoklonale Antikörper der erwünschten Spezifität sezernierenden Rybridomen unter Verwendung der Milz dieses Tieres als Quelle für Antikörper erzeugende Zellen, nachdem einmal der über 50-prozentige Bindungstiter erreicht ist, im wesentlichen gesichert ist, abgesehen vom Auftreten zufalliger Laborunfälle, wie einer Kontamination der Zellkulturen oder einer anderen Zerstörung dieser Kulturen.

Es wird angemerkt, daß das Immunisierungsprotokoll, welches erforderlich ist, um für einen Hyperimmunzustand zu sorgen, bekannterweise unter anderem eine Funktion des Tiertypus, des Gewichts des Tieres, der Immunogenität und der Mengen des Polypeptids und des Trägers, falls verwendet, des Adjuvans, falls verwendet, der Anzahl der Immunisierungen, die innerhalb eines gegebenen Zeitraums verabreicht werden, ist. Das oben beschriebene Protokoll zum Erhalt eines 50prozentigen Bindungstiters bei einer Verdünnung von wenigstens etwa 1:400 sorgt für einen Hyperimmunzustand in der Versuchsmaus und kann als eine proportionierbare Basis für die Herbeiführung hyperimmuner Zustände in anderen Tieren verwendet werden. Es wird ferner festgestellt, daß drei Immunisierungen nicht nötigerweise erforderlich sind, um für den hyperimmunisierten Zustand zu sorgen. Für ein nützliches Polypeptid jedoch sind drei solcher Immunisierungen während eines Zeitraumes von einem Monat ausreichend, um diesen Zustand zu erzeugen, oder das Polypeptid ist nicht hinreichend immunogen für die Erzeugung der Hybridome und ihrer monoklonalen Antikörper dieser Erfindung bei hohem Ertrag.

Die in dem hyperimmunisierten Tier so hergestellten oligoklonalen Rezeptormoleküle des Serums binden ebenfalls an den Proteinmolekülliganden, wobei das immunogene Polypeptid einem Teil von diesem in der Aminosäurerest-Sequenz entspricht. Bindungsassays werden hier nachstehend in dem Materialien- und Methodenteil beschrieben. Es wird festgestellt, daß eine reine Probe des Proteinmolekülliganden nicht in diesen Assays verwendet werden muß, sondern stattdessen ein Zellextrakt oder eine Gewebepräparation, wie ein den Proteinliganden enthaltender Mikroskop-Objektträger verwendet werden kann.

Das hyperimmunisierte Tier wird gehalten, d.h. ohne eine Verabreichung weiterer Immunisierungen während eines Zeitraums von wenigstens etwa 30 Tagen nach der Verabreichung der Immunisierung, welche einen Soprozentigen Bindungstiter bei einer Verdünnung von wenigstens etwa 1:400 erzeugt, am Leben gelassen. Mit anderen Worten wird das Tier zuerst immunisiert, um für einen hyperimmunisierten Zustand zu sorgen, und dann wird der Hyperimmunisierung gestattet, zurückzugehen.

Der Abfall der Bindungsaktivität dauert bei Mäusen typischerweise einen bis etwa fünf Monate. Dieser Abfall des Bindungstiters, so glaubt man, entspricht einem Zeitraum, in welchem geprimte Blastzellen dazu fähig werden, eine starke Antwort auszulösen, wenn das Immunogen erneut eingeführt wird.

Dem Tier wird eine Booster-Immunisierung, wie durch eine intravenöse Injektion unter Verwendung des immunogenen Polypeptids oder seines Konjugats, nachdem der Zeitraum des Auftechterhaltens abgeschlossen ist, z. B. mindestens dreißig Tage nach der letzten Immunisierung, verabreicht. Antikörper-erzeugende Zellen, wie Milzzellen oder Lymphzellen, des geboosteten Tiers werden dann mit einer Myelomzelle desselben Tiertyps (Spezies) innerhalb eines Zeitraumes von etwa drei bis etwa fünf Tagen nach dem Tag der Booster- Verabreichung, füsioniert, um Hybridomzeilen herzustellen. Man glaubt, daß der Booster die Reifüng der Blastenzellen bis zu dem Punkt stimuliert, an welchem diese Zellen nahezu optimale Mengen oligoklonaler Antikörper gegen das Polypeptid sezernieren.

Die Hypoxanthin-Aminopterin-Thymidin-(HAT)-sensitive Myelomzellinie SP2/O-Ag14 (ATCC CRL 1 581) wird für die Verwendung bei der Fusion mit Milzzellen der Maus bevorzugt, obwohl andere Zellinien, wie P3X63-Ag8.653, ebenso verwendet werden können. Details unter Verwendung dieser HAT-Linie zur Fusion werden hier nachstehend in dem Materialien- und Methodenteil angegeben. Die Hybridomzellen werden danach unter einer limitierenden Verdünnung, frei von der Gegenwart von oder dem Bedarf an Fütterschichten aus Makrophagen, kloniert, um das Überwachsen durch nicht-produzierende Zellen zu reduzieren und ein Selektionsverfahren für Zellen, welche ohne weiteres unter in vitro- Bedingungen wachsen, bereitzustellen. Solche Fütterschichten können jedoch verwendet werden.

Die so hergestellten Hybridomzellen werden dann auf die Herstellung (Sekretion) monoklonaler Rezeptormoleküle, welche an den Proteinmolekülliganden binden, getestet. Dieser Ligand ist ein Teil des Proteins, welchem das immunogene Polypeptid in der Aminosäurerest- Sequenz entspricht. Danach werden die Hybridomzellen, welche die monoklonalen Rezeptormoleküle, die an den Proteinliganden binden, erzeugen, weiter kultiviert, um zusätzliche Mengen dieser Hybridomzellen und der monoklonalen, durch diese Zellen sezernierten Rezeptoren, die an den Proteinmolekülliganden binden, herzustellen. Typischerweise wird ein solches Kultivieren bei einer limitierenden Verdünnung vorgenommen, z. B. bei einem Durchschitt von etwa einer Zelle pro Kulturwachstums-Vertiefüng.

In der bevorzugten Praxis werden die Hybridomzellen, die hergestellt werden, ebenfalls auf die Produktion monoklonaler Rezeptormoleküle, die an das Polypeptid-Immunogen genauso wie an den Proteinliganden binden, getestet. Danach sind diejenigen Hybridomzellen, welche monoklonale Rezeptormoleküle, die sowohl an das immunogene Polypeptid als auch an den Proteinliganden binden, diejenigen Zellen, die bevorzugterweise kultiviert werden.

Wo Proben des Proteinmolekülliganden begrenzt sind, ist es angebracht, die Hybridome zunächst auf eine Sezernierung monoklonaler Rezeptoren zu screenen, die an das immunogene Polypeptid binden. Klone der Hybridome, die ein positives Binden an dieses Polypeptid zeigen, werden dann zur Lagerung typischerweise eingefroren. Danach werden sie aufgetaut und durch Grenzverdünnung subkloniert, um zu gewährleisten, daß wirklich monoklonale Antikörper statt einer Mehrzahl monoklonaler Rezeptoren, welche von einer Mehrzahl unterschiedlicher Hybridomzellen hergestellt werden, produziert werden. Diese Grenzverdünnungs-Subklonierungskulturen werden wiederum typischerweise frei von Fütterschichtenschichten oder Makrophagen, da solche nicht nötig sind, durchgeführt.

Die Hybridomzellen, die schießlich hergestellt wurden, können kultiviert werden, indem üblichen In- Vifro-Gewebekulturverfahren für solche Zellen gefolgt wird, wie sie gut bekannt sind. Stärker bevorzugt werden die Hybridomzellen in Tieren unter Verwendung ähnlich gut bekannter Verfahren kultiviert, wobei die monoklonalen Rezeptoren aus der so erzeugten Aszitesflüssigkeit erhalten werden. Die für die Erzeugung der Aszitesflüssigkeit verwendeten Tiere sind typischerweise 129xBALB/c-Mäuse, gezüchtet in der Mäusekolonie der Scripps Clinic and Research Foundation, La Jolla, Kalifornien. Wenn jedoch andere Tiere als Mäuse zur Herstellung der Hybridome verwendet werden, wird dieser Tiertyp für die Erzeugung der Aszitesflüssigkeit verwendet.

Wie zuvor bemerkt, wird es bevorzugt, daß die Myelomzellinie aus derselben Spezies wie der Rezeptor ist. Daher werden füsionierte Hybride wie Maus-Maus-Hybride [Shulman et al Nature 276: 269 (1978)] oder Ratten-Ratten-Hybride [Galfre et al Nature 277:131(1979)] typischerweise verwendet. Es wurden jedoch auch einige Ratten-Maus-Hybride erfolgreich bei der Bildung von Hybridomen verwendet [Goding "Production of Monodonal Antibodies by Cell Fusion" in Antibody as a Tool, Hrsg.: Marchalonis et al., John Wiley & Sons Ltd., S. 273 (1982)]. Geeignete Myelomlinien zur Verwendung in der vorliegenden Erfindung schließen MPC-11 (ATCC CRL 167), P3X63-Ag8.653 (ATCC CRL 1 580) Sp2/0-Ag14 (ATCC CRL 1 581), P3X63-Ag8U.1 (ATCC CRL 1 597) und Y3-Agl.2.3. (hinterlegt in der Collection Nationale de Cultures de Microorganismes, Paris, Fränkreich, Nr.I-078) und P3X63Ag8 (ATCC TIB 9), ein. Die Myelomlinien SP2/0-Ag14 und P3X63-Aq 8.653 werden zur Verwendung in der vorliegenden Erfindung bevorzugt.

Daher ist es, indem man dem hier vorstehend beschriebenen Verfahren folgt, möglich, relativ hohe Erträge monoklonaler Rezeptoren, welche an bekannte, festgelegte Epitope von Proteinmolekülen, wie Onkoproteinen, binden oder mit ihnen eine Immunreaktion eingehen, herzustellen. Darüber hinaus kann, sobald der Fachmann ein oligoklonale Antikörper enthaltendes Hyperimmunserum, welches einen Soprozentigen Bindungstiter von wenigstens etwa 1:400 an das immunisierende Polypeptid zeigt, hergestellt hat, dieser den vorstehend erwähnten Schritten folgen, die Milz aus dem hyperimmunisierten Tier entnehmen, ihre Antikörper-erzeugenden Zellen mit Zellen einer Myelomzellinie vom selben Tiertyp oder -stamm füsionieren, und im wesentlichen sicher sein, daß eines oder mehrere der aus dieser Fusion erzeugted Hybridome monoklonale Rezeptoren sezernieren, welche an das immunisierende Polypeptid und an das entsprechende Protein, wie ein Onkoprotein, binden. Solche Ergebnisse wurden bisher nicht beschrieben.

Das obenstehende Verfahren ist nützlich für die Herstellung von Hybridomen, welche monoklonale Rezeptoren gegen im wesentlichen jeden beliebigen Proteinmolekülliganden sezernieren. Erläuternd für solche Hybridome und ihre monoklonalen Rezeptoren sind diejenigen, die gegen immunogene Polypeptide mittlerer Länge erzeugt wurden, deren Aminosäurerest- Sequenzen den Aminosäurerest-Sequenzen von Onkoproteinen, die von Onkogenen codiert sind, entsprechen. Beispielhafte Onkogene und nützliche immunogene Polypeptide sind nachstehend gezeigt, gefolgt von der in Klammern gesetzten numerischen Position vom Aminoende in der Onkoproteinsequenz, der das Polypeptid entspricht, ausgehend, wobei die Aminosäurerest-Sequenzen dieser Polypeptide von links nach rechts in der Richtung vom Aminoende zum Carboxyende angegeben sind und durch eine Formel, ausgewählt aus der aus den in Tabelle 1 nachstehend gezeigten Formeln bestehenden Gruppe, repräsentiert werden.

Tabelle 1

¹Literaturzitate für die obenstehenden Onkogene und Sequenzen.

v-sis - Devare et al., Proc. Natl Acad. Sci. USA 79: 3 179-3 182 (1982).

c-sis - Johnsson et al., EMBO J.3: 921-928 (1984).

PDGF-1 - Doolittle et al., Science 221: 275-277 (1983).

PDGF-2 - Doolittle et al., Science 221: 275-277 (1983).

v-fesST-Hampe et al.,Cell30: 775-785(1982).

v-myb - Rushlow et al., Science 216: 1 421-1 423 (1982).

v-rasHa - Dhar et al., Science 217: 934-937 (1982).

v-rasKi - Tsuchida et al., Science 217: 937-939 (1982).

T24-rasHu - Reddy et al., Nature 300: 149-152 (1982).

N-RAS - Taparowski et al., Cell 34 581 (1983).

H-RAS - Capon et al, Nature 302: 33 (1983).

K-RAS - McGrath et al., Nature 304: 501 (1983).

rasK4B - Chardin et al., EMBO J. 5: 2 203 (1986).

v-bas-Reddy et al, J Virol 53: 984 (1985).

MYC - Colby et al., Nature 301: 722-725 (1983).

N-MYC - Kohl et al., Nature 319: 73 (1986).

L-MYC-Nau et al., Nature 318: 69 (1985).

v-mos - Van Beveren et al.,et al., Nature 289: 258-262 (1981).

c-mos- Vanbeveren et al., Cell 27: 97 (1981).

MOS - Watson et al., Proc. Natl Acad Sci. USA 79: 4 078 (1982).

v-erb-B - Yamamoto et al., Cell 35: 7(1983).

neu - Bargmann et al., Nature 319: 226 (1986).

HER-1 - Ullrich et al., Nature 309: 481 (1984).

v-src - Takeya et al., J Virol 44: 12 (1982).

v-srcPC - Schwartz et al., Cell 32 853 (1983).

v-srcSRA - Czernilofsky et al., Nature 287: 198 (1980).

SRC-Parker et al., Mol Cell. Biol 5:831 (1985).

-vfgr - Naharro et al., Science 223: 63 (1984).

int-1 - Ooyen et al., EMBO J. 4: 2905 (1985).

v-yes - Kitamura et al., Nature 297: 205 (1982).

v-mil - Sutrave et al., Nature 309: 85 (1984).

v-raf- Mark et al., Science 224: 285 (1984).

RAF - Bonner etal, Nuc. Acid Res. 14:1 009 (1986).

A-RAF - Huleihel et al., Mol. Cell Biol 6: 2 655 (1986).

PKS - Mark et al., Proc. Natl. Acad Sci. USA 83: 6 312 (1986).

v-rel - Stephens et al., Proc. Natl Acad. Sci. USA 80: 6 229 (1983).

v-fms - Hampe etal, Proc. Natl Acad Sci. USA 81: 85 (1984).

FMS - Coussens et al., Nature 320: 277 (1986).

v-abl I - Reddy et al., Proc. Natl Acad Sci. USA 80: 3 623 (1983).

c-abl I - Ben-Nerich et al., Cell 44: 577 (1986).

c-abl II - Ben-Nerich et al., oben.

c-abl III - Ben-Nerich et al., oben.

c-abl IV - Ben-Nerich et al., oben.

BPK C - Shoji et al., Proc. Natl Acad Sci. USA 78: 848 (1981).

BPK R - Shoji et al., Biochem. 22: 3 702 (1983).

CDC 28 - Lorincz et al., Nature 307: 183 (1984).

v-fps - Shibuya et al., Cell 30: 787 (1982).

c-fps-Huang et al.,J. Mol. Biol. 181: 175 (1985).

v-ros - Neckameyer et al., S. Virol 53: 879 (1985).

HIR- Ullrich etal, Nature 313: 756 (1985).

TRK Martin - Zanca et al., Nature 319: 743 (1986).

v-kit- Besmer et al., Nature 320: 415 (1986).

PKC - Kropf et al., Ce11 46: 491 (1986).

pim-1 - Selten et al., Cell 46: 603 (1986).

syn - Semba et al., Proc. Natl Acad. Sci. USA 83: 5 459 (1986).

Gs - Itoh etal., Proc. Natl Acad. Sci. USA 83: 3 776 (1986).

Gi-Itoh et al., oben.

Go - Itoh et al., oben.

T - Itoh et al., oben.

T' - Itoh et al., oben.

PBK-Reiman e al., Biochem. 23: 4 185 (1984).

CGK- Takio et al., Biochem. 23: 4207 (1984).

MLCK - Takio et al., Biochem. 24: 6 028 (1985).

c-lsk-Marth et al., Cell 43: 393 (1985).

MET - Dean et al., Nature 318: 385 (1985).

FOS - Cochran et al., Science 226:1 080 (1984).

c-fos - van Straaten et al., Proc. Natl Acad. Sci. USA 80: 3 138 (1983).

v-erb-A - Weinberger et al., Nature 318: 670 (1985).

c-erb-A - Weinberger et al., Nature 324: 641 (1986).

HGR - Hollenberg et al., Nature 318: 635 (1985).

ER - Green et al., Science 231: 1150 (1986).

CPR -Conneely et al., Science 233: 767 (1986).

Beta-TGF Derynck et al Nature 316: 701 (1985).

²Die numerische Position des Polypeptids war nicht verfügbar, da die berichtete Sequenz unvollständig war.

³Diese Polypeptide enthalten einen deletierten, zusätzlichen oder substituierten Aminosaurerest, verglichen mit den berichteten Sequenzen.

Die homologen, von den oben genannten vier ras-Genen codierten Polypeptide können angemessenerweise als eine Aminosäurerest-Sequenz, von links nach rechts und in der Richtung vom Aminoende zum Carboxyende geschrieben werden, dargestellt durch die Formel

KVVVGAR (S, V,G) GVGK

worin die Aminosäurereste in Klammern jeweils eine Alternative zu dem direkt vorausgehenden Aminosaurerest "R" in der Formel sind.

Noch weitere nützliche Polypeptide zur Einleitung der Erzeugung monoklonaler Rezeptoren zur Verwendung gemaß der Erfindung sind die Polypeptide, deren Onkogene, Position in der Sequenz des Onkoproteins und Polypeptid-Aminosäurerest-Sequenzen in den Figuren 20, 21 und 22 gezeigt sind. Diese Polypeptide entsprechen Bereichen mit konservierter Sequenz in der gut bekannten Familie der Proteinkinase-Onkoproteine, von der einige Onkoproteine hierin zuvor erwähnt wurden.

II. Monoklonale Rezeptoren

Während die vorliegende Erfindung die Verwendung einer großen Anzahl von monoklonalen Rezeptoren betrachtet, werden hierin nur relativ wenige von diesen betrachteten Rezeptoren, m der Form intakter monoklonaler Antikörper (Mab's), als veranschaulichend für die Gruppe ausführlich erörtert werden. Der zuvor besprochene Test auf die Immunogenität und Antigenität eines Polypeptids wird danach für Polypeptide, die zusätzlichen monoklonalen Rezeptoren entsprechen, welche andere Onkoproteine binden (damit eine Immunreaktion eingehen), erörtert werden.

A. Exemplarische Rezeptoren

Unter Verwendung der hierin erörterten Vorgehensweisen, wurden exemplarische monoklonale Rezeptoren gegen Onkogen-verwandte Polypeptide herangezogen. Monoklonale, für die Ausführung der Erfindung nützliche Rezeptoren sezernierende Hybridome wurden bei der "American Type Culture Collection" (ATCC) in Rockville, MD, gemaß dem Budapester Vertrag hinterlegt. Eine Liste dieser Hinterlegungen, einschließlich ihrer ATCC- Zugangsnummer (ATCC-Nr.), der Labor-Referenznummer (Ref-Nr.), dem Datum des Eingangs bei der ATCC (ATCC-Eingang) und der Nummer der immunisierenden Polypeptide, als Querverweis zu den Polypeptiden von Tabelle 1 (Polypep. Nr.), ist in der Tabelle 2 nachstehend angegeben.

Tabelle 2

¹Das Hybridom P44E11 wurde unter Verwendung der Myelomzellinie P3X63 -Ag 8.653 hergestellt. Alle anderen Hybridome wurden unter Verwendung der Myelomzellinie SP2-0 hergestellt, wie in dem Materialien- und Methodenteil erörtert.

Fünf exemplarische, monoklonale Rezeptoren sezernierende Hybridome wurden gegen das v-fes-verwandte, 30-mere immunogene, synthetische, unten gezeigte Polypeptid (Polypeptid Nr. 125, auch als Polypeptid a bezeichnet), gezogen, und ein jeder bindet ebenfalls an das carboxyterminale 12-mere, unten gezeigte Polypeptid (Polypeptid 126, auch als Polypeptid b bezeichnet), wobei sie ebenfalls an das als "p85" bezeichnete (85 kD) Onkoprotein binden, welches durch das v-fes-Gen von ST-FeSV codiert wird. Diesen Hybridomen wurden die Referenznummern S10F03, S22C06, P43D09, P42C10 und P44E11 gegeben. Die Aminosäurerest-Sequenzen der synthetischen Polypeptide (a) und (b) von links nach rechts und in der Richtung vom Aminoende zum Carboxyende werden dargestellt durch die Formeln

Polypeptid a SDVWSFGILLWETFSLGASP-YPNLSNQQTR;

Polypeptid b SPYPNLSNQQTR.

Die sieben, bei der ATCC hinterlegten Hybridome aus der Tabelle 2, die gegen das v-fesverwandte Polypeptid Nummer 127 herangezogen wurden und in Tabelle 1 gezeigt sind, sind unter den neunzehn Hybridomen, die gegen dieses Polypeptid erzeugt wurden. Die monoklonalen Rezeptoren, die durch diese sieben Hybridome sezerniert werden, binden ebenfalls an das Onkoprotein p85.

Die von den als S22C06 und S10F03 bezeichneten Hybridomen sezermerten monoklonalen Rezeptoren sind in besonderer Weise bevorzugte monoklonale Rezeptoren. Beide bevorzugte monoklonale Rezeptoren sind monoklonale IgG1-Rezeptoren mit Kappa-Leichten-Ketten, die mit dem immunisierenden Polypeptid und mit dem fes-verwandten Onkoprotein mit einer Aminosäurerest-Sequenz, die der Sequenz des immunisierenden Polypeptids entspricht, eine Immunreaktion eingehen.

Ein Hybridom wurde unter Verwendung des 23-meren, immunogenen, synthetischen, unten gezeigten ras-Polypeptids Nr 142 (ras) herangezogen:

YREQIKRVKDSDDVPMVLVGNKC

Der von diesem Hybridom sezernierte monoklonale Antikörper bindet an das immunogene Polypeptid und bindet ebenfalls an das 55 kD große Protein, welches von dem ras-Gen der Harvey-Sequenz codiert wird. Der monoklonale Antikörper erkennt ein 23 kD großes Protein in allen ras-erzeugenden Zellinien, die getestet wurden, sowie ein Protein von höherem Molekulargewicht.

Die als S10F03, S22C06, P43D09, P44E11 und 1/24/E05 bezeichneten Hybridome sezernieren monoklonale IgG1 -Rezeptoren mit Kappa-Leichter-Kette.

Die zuletzt genannten fünf Hybridome wurden aus drei getrennten Zellfüsionen erzeugt. Die Effektivität bei der Erzeugung von Hybridomen, deren Mab's das immunogene Polypeptid sowie den entsprechenden Onkoprotein-Molekülliganden erkennen, war bei der ersten Präparation 100 Prozent; d.h. zwei Mab's (aus S10F03 und S22C06) wurden erzeugt, die das Polypeptid erkennen, und diese beiden Mab's erkennen ebenfalls das Onkoprotein. Bei der zweiten und dritten Präparation war die entsprechend berechnete Effizienz etwa 20 Prozent.

Ein anderes Hybridom wurde unter Verwendung des erb-B-verwandten, 1 6-meren, immunogenen, synthetischen, nachstehend gezeigten Polypeptids Nr.171, gezogen. Die Aminosaurerest-Sequenz des synthetischen Polypeptids, von links nach rechts und in der Richtung vom Aminoende zum Carboxyende wird durch die folgende Formel dargestellt:

IMVKCWMIDADSRPKF.

Der monoklonale von diesem Hybridom sezernierte Antikörper bindet ebenfalls an die mit den Onkoproteinen, die durch die Onkogene fes, fms, abl, src und fgr codiert werden, verwandten Polypeptide.

Die Figur 1 erläutert den immunologischen Nachweis des Onkoproteinliganden p85 durch die von den Hybridomen S10F03 (ATCC HB 8 596) und S22C06 (ATCC HB 8 595) sezernierten monoklonalen Rezeptoren unter Verwendung eines externen Standards für den Onkoproteinliganden p85 und einen das Influenza-Hämagglutinin erkennenden Mabs als einer Negativkontrolle. Die Figur 2 erläutert ähnliche Ergebnisse, wiederum unter Verwendung von Mab's aus dem Hybridom S10F03, sowie von Mab's der Hybridome P43D09 (ATCC HB 8 594) und P44E11 (ATCC HB 8 593), und ebenfalls des Hybridoms P42C10. Ein monoklonaler Antikörper gegen das als "gp70" bezeichnete Rauscher-Virus-Protein (Niman und Elder in Monodonal Antibodies and T Cell Products, siehe oben) wurde als eine Negativkontrolle verwendet.

Die Figur 3 erläutert weiter die Spezifität der monoklonalen Rezeptoren, wie hier vorstehend beschrieben. CCL64-Nerzzellen (Spuren B und C) oder MSTF-Zellen, infiziert mit FeLV-B und FeSV (Spuren A und B) wurden radioaktiv mit ³²P markiert. Extrakte aus den markierten -Zellen wurden dann entweder mit einem Ziegenantiserum gegen das Protein p15, codiert von dem gag-Anteil des v-fes-Gens und exprimiert als der als "pr65" bezeichnete Proteinvorläufer (Spuren A und B), oder mit Gewebekulturüberstand von dem Hybridom S10F03 (Spuren C und D) inkubiert.

Wie ersichtlich ist, band der Mab aus dem Hybridom S10F03 nur an den Onkoproteinliganden p85 (Spur C), während das Ziege-Anti-p15-Serum sowohl an das pr65- als auch das p85- Fusionsonkoprotein aus den infizierten Zellen band (Spur A). Aus den uninfizierten Zellen (Spuren B und D) wurden keine Proteine gebunden. Diese Ergebnisse und, durch Analogie, die Diskussion des die Figur 13 betreffenden Assays bestätigen, daß die betreffenden Mab's nur an den Onkoproteinliganden (p85) binden, wobei ein Teil von dessen Aminosäurerest-Sequenz der Sequenz des immunogenen Polypeptids entspricht, welches verwendet worden ist, um das Hybridom, das jeden Mab sezerniert, herzustellen.

In ähnlichen, nicht gezeigten, Ergebnissen banden die Mabs der obengenannten fünf Hybridome ebenfalls an den 108 kD großen Onkoproteinliganden, der in Zellen, die durch GA- FeSV transformiert sind, exprimiert wird. Der von dem Stamm GA-FeSV codierte Onkoproteinligand ist im wesentlichen in der Aminosäurerest-Sequenz mit dem durch den Stamm ST-FeSV codierten Onkoproteinliganden, in der Region des immunogen nützlichen Polypeptids, identisch; siehe Hampe el al., Cell 30: 777-785 (1982).

Keiner der obengenannten fünf Mab's band an das von dem v-fps-Gen des Fujinami-Stammes des Vogel-Sarkom-Virus codierte Onkoprotein. Das vorausgesagte Onkoprotein v-fps, dessen Sequenz von Shibuja el aL, Cell 30: 787 (1982), berichtet wird, enthält ebenfalls ausgedehnte Homologien zu dem vorausgesagten Onkoprotein v-fts und weicht in dem, dem oben genannten 12-mer (Polypeptid b) entsprechenden Bereich nur durch die Substitution des ersten und des vierten Restes vom Aminoende dieses 12-meren Polypeptids ab, d.h. das aminoterminale Serin (S) des v-fts-verwandten Polypeptids und Onkoproteins ist durch ein Valin (V) in dem v-fps-verwandten Onkoprotein ersetzt, und der zweite Prolinrest (P) vom Aminoterminus ist durch einen Alaninrest (A) ersetzt.

Die Nicht-Bindung der obengenannten Mabs an das v-fps-verwandte Onkoprotein stellt eine Basis für die Unterscheidung zwischen exprimierten Onkoproteinen in transformierten Zellen und für das Testen auf das Vorhandensein des v-fes-verwandten Onkoproteinliganden in Gegenwart des v-fps-verwandten Onkoproteins bereit. Diese Unterscheidung bei der Bindung kann ebenfalls nützlich sein bei der Reinigung einer Mischung beider Proteine durch eine Affinitätschromatographie unter Verwendung eines Mab's dieser Erfindung als ein Teil eines Affinitätssorptionsmittels, wie es hier nachstehend erörtert wird.

Die oben besprochenen Ergebnisse des Nicht-Bindens von monoklonalen Antikörpern gegen das v-fps-verwandte Onkoprotein stellen ebenfalls die Verbesserung der Spezifität der betreffenden monoklonalen Rezeptoren gegenüber zuvor erhaltenen oligoklonalen Rezeptoren heraus. Daher verwendeten Sen . Proc. Natl. Acad. Sci. USA 80:1 246-1 250 (1983) das obenstehende Polypeptid (b), konjugiert mit KLH, um oligokionale Kaninchenantikörper herzustellen. Diese oligoklonalen Antikörper banden an Onkoproteine, welche von durch ST- FeSV, GA-FeSV und FSV (Fuginami-Sarkom-Virus) transformierten Zellen exprimiert wurden, die die Onkogene vfesST, v-fesGA bzw. v-fps enthielten. Es ist daher ersichtlich, daß die Spezifität, die durch monoklonale Rezeptoren, die hergestellt wurden, wie es hierin beschrieben ist, erhalten wird, stark verbessert ist gegenüber deijenigen, die durch oligoklonale Rezeptoren erhalten wird, sogar wenn beide gegen dasselbe immunogene Polypeptid herangezogen werden.

In einer ähnlichen Weise werden Hybridome hergestellt, die monoklonale Rezeptoren sezernieren, welche an Onkoproteinmolekülliganden binden, z.B. an PDGF, an immunogene Polypeptide, die von den retroviralen als fes, myb, fos, 515, ras, myc und mos bezeichneten Onkogenen codiert werden, sowie an immunogene Polypeptide, deren Sequenzen den Sequenzen der Onkoproteine entsprechen, die von den als fps, src, yes, fgr, bas, int-1, fins, erb-A, erb-B, mil, raf (mil/raf), abl und ros bezeichneten Onkogenen codiert werden, sowie an die Wachstumsfaktoren PDGF-1, PDGF-2, EGF, TGF-alpha, und ebenso an Onkoproteine, die in durch Retroviren, welche diese Gene enthalten, transformierten Zellen exprimiert werden. Spezifische monoklonale Rezeptoren zur Verwendung gemäß Verfahren der Erfindung binden an ein, von den obengenannten Onkogenen codiertes, immunogenes Polypeptid.

Einige von diesen Onkogenen werden unten in Tabelle 3 genannt und sind neben den Polypeptidnummern, entsprecherd den Onkogenen, Sequenzen und Polypeptidnummern von Tabelle 1, an welche die bevorzugten monoklonalen Rezeptoren dieser Erfindung binden, erläutert. Daten, welche sich auf das Binden von wenigstens einem monoklonalen Rezeptor (Mab) oder oligoklonalem Antiserum (Serum), gezogen gegen jedes Polypeptid, in einer Western-Blot-Analyse beziehen, werden ebenfalls in Tabelle 3 neben der Polypeptidnummer gezeigt.

Tabelle 3 Bindung von Rezeptoren an Onkoproteine¹

¹Binden von Rezeptormolekülen an Onkoproteine in Westernblot-Analysen. Das Zeichen Plus (+) stellt dar, daß eine Bindung gezeigt wurde. NT = nicht getestet.

²Polypep. Nr. = Polypeptidnummer aus Tabelle 1.

³Binden eines monoklonalen Rezeptormoleküls an ein Onkoprotein.

&sup4;Binden eines oligoklonalen Anti-Polypeptid-Serums an ein Onkoprotein.

Die für die Induktion der Produktion oligoklonaler Rezeptoren und letztendlich für die Herstellung monoklonaler Rezeptoren nützlichen Polypeptide sind bevorzugtermaßen mit einem Trägermolekül verknüpft, wie hierin besprochen, worin die mit KLH verknüpften Polypeptide die ganze Zeit über als erläuternde Polypeptid-Träger-Konjugate verwendet worden sind. Es wird für Polypeptide, die weniger als etwa 35 Aminosäurereste enthalten, bevorzugt, einen Träger zum Zweck der Induktion der Herstellung oligoklonaler und monoklonaler Rezeptoren zu verwenden. Etwa 35 bis etwa 40 Aminosäurereste enthaltende Polypeptide können allein verwendet werden, ohne Verknüpfüng mit einem Träger, um die Herstellung von Rezeptor zu induzieren, obwohl es immer noch zu bevorzugen ist, einen Träger für die Erzeugung dieser Rezeptoren zu verwenden. Daher können die Rezeptoren induziert werden durch oder herangezogen werden gegen ein Polypeptid allein, oder verknüpft mit einem Träger.

B. Immunisierungs-Bindungs-Untersuchungen

Wie verschiedene Male festgestellt, sind die zum Heranziehen oligoklonaler Antikörper und Hybridome, welche monoklonale Antikörper sezermeren, verwendeten Polypeptide selbst immunogen und antigen, und diese Eigenschaften stellen Kriterien zur Identifizierung nützlicher Polypeptide für die Herstellung eines Hybridoms bereit. Die nachstehende Diskussion bezieht sich auf Untersuchungen mit oligoklonale Antikörper (Rezeptor) enthaltenden Antiseren, induziert durch oder gezogen gegen Polypeptide, die bei der Herstellung von Hybridomen verwendet wurden, die monoklonale Rezeptoren (Antikörper) gegen die von den Onkogenen ras, sis, erbB und myb codierten Onkoproteine sezernieren. Wie beschrieben werden wird, induziert das sis-verwandte Polypeptid die Erzeugung oligoklonaler Rezeptoren, die nicht nur an das Polypeptid binden, sondern ebenfalls an ein entsprechendes Onkoprotein, den humanen von Blutplättchen abgeleiteten Wachstumsfaktor (PDGF). Die auf diese Weise hergestellten oligoklonalen Antikörper wiesen den zuvor beschriebenen 50-prozentigen Bindungstiter gegen das immunisierende Polypeptid auf, wodurch gezeigt wird, daß monoklonale Antikörper (Rezeptoren) dieser Erfindung ebenfalls durch eine Fusion der Antikörper erzeugenden Splenozyten mit Zellen einer geeigneten Myelomlinie erzeugt werden können.

Aus Blutplättchen isoliertes PDGF besteht aus zwei Ketten, die am aminoterminalen Ende etwa zu 60 % homolog sind. Eine von diesen Ketten (PDGF-2) ist im Grunde genommen mit einem Teil des Genproduktes (p28sis) des Affen-Sarkom-Virus (v-sis) identisch. Die Sequenzierung des humanen c-sis und des v-sis enden an derselben Position, und das Molekül PDGF-2 stammt von einem größeren Vorläufer, welcher eine ausgedehnte Homologie mit p288i5 hat. Die Homologie zwischen p28sis und PDGF-2 beginnt an dem Aminosäurerest 67 von p28sis und dem Aminoende von PDGF-2 und wurde vor kurzem auf das vorausgesagte Carboxyende von p28sis über die Isolation und Sequenzierung eines humanen Klons von c-sis ausgedehnt [Josephs et al., Science 223: 487-491(1984)].

p28sis wird schnell gespalten, um p2osis zu erzeugen, welches vermutlich dasselbe Aminoende wie PDGF-2 hat. Innerhalb des für p20sis und PDGF-2 codierenden Bereichs gibt es acht Austausche von Aminosäuren, die in drei Bereichen plaziert werden können. Die zwei Austausche nahe bei dem Aminoende sind konservativ, fünf Austausche sind in der Nähe des Zentrums des Moleküls gedustert bzw. gehäuft, und ein Austausch ist in dem Carboxyterminalen Teil lokalisiert.

Zwei exemplarische Polypeptide wurden hergestellt. Das erste, Polypeptid 113 genannte, ebenfalls als Polypeptid (c) bezeichnete, entspricht in der Aminosäurerest-Sequenz den Resten 139 bis 155 der vorausgesagten Sequenz des transformierenden, als p28sis bezeichneten Proteins des Affen-Sarkom-Virus [Devare et al., Proc. Natl. Acad Sci USA 80: 731-735 (1983)]. Die Sequenz des Polypeptids (c) entspricht ebenfalls der Sequenz der Positionen 73 bis 89 des Aminoendes der als PDGF-2 bezeichneten Proteinkette des humanen, von Blutplättchen abgeleiteten Wachstumsfaktors, wie zuvor bemerkt wurde. Das zweite, als Nummer 131 bezeichnete, ebenfalls als Polypeptid (d) bezeichnete, Polypeptid entspricht in der Aminosaurerest-Sequenz den Resten 2 bis 18 der vorausgesagten Sequenz des transformierenden Proteins des Vogel-Myoblastose-Virus, dem (v-myb) Onkoprotein et al., Science 216:1 421-1 423 (1982)]. Die Aminosäurerest-Sequenzen der Polypeptide (c) und (d) sind unten von links nach rechts und in der Richtung vom Aminoende zum Carboxyende gezeigt:

Polypeptid (c) RKIEIVRKKPIFKKATV;

Polypeptid (d) RRKVEQEGYPQESSKAG.

Ein jedes von den Polypeptiden wurde synthetisiert und unter Verwendung eines Cys-Restes ihrer Carboxyenden (nicht in den obenstehenden Formeln gezeigt) an KLH gebunden, und jedes resultierende Konjugat wurde dann verwendet, um Mäuse, wie allgemein in dem Materialien- und Methodenteil erörtert, zu immunisieren. Wie aus einer Untersuchung der Figur 4 ersichtlich ist, enthielten die gegen das Polypeptid (c) gezogenen Seren oligoklonale Rezeptoren, die an das Polypeptid als auch an KLH binden, und Seren, die gegen das Polypeptid (d) gezogen wurden, enthielten oligoklonale Rezeptoren, die an das Polypeptid (d) und an KLH binden. Keines der Seren enthielt Rezeptoren, die kreuzreagierten und an das Polypeptid binden, das nicht verwendet wurde, um sie zu erzeugen.

Extrakte von gealterten humanen Blutplättchen wurden verwendet, um partiell gereinigte Proben von PDGF zu erhalten. Wie bereits festgestellt, ist PDGF ein Onkoprotein mit einem apparenten bzw. scheinbaren Molekulargewicht von etwa 30 kD, das reduktiv in zwei Polypeptide hohen Molekulargewichts mit ähnlichen apparenten Molekulargewichten gespalten werden kann, die als PDGF-1 und -2 bezeichnet werden.

Die Figur 5 zeigt die Ergebnisse der Western-Blot-Analyse von PDGF unter Verwendung der oligokionalen Rezeptor enthaltenden, gegen die Polypeptide (c) und (d) gezogenen Antiseren, wie es ausführlicher in der Beschreibung dieser Figur erörtert wird. Das gegen das Polypeptid (d) gezogene Antiserum wird dabei als eine Negativkontrolle verwendet. Wie aus einer Untersuchung der Figur 5 gesehen werden kann, band das oligoklonalen Rezeptor enthaltende, gegen das sis-verwandte Polypeptid, Polypeptid (c), gezogene Serum an drei proteinartige Komponenten (Spur 2). Eine von diesen Komponenten hatte ein apparentes Molekulargewicht von etwa 30 kD und zwei jeweils von etwa 16-18 kD. Die Spur 4 erläutert ebenfalls das Binden durch oligoklonale Rezeptoren, die in dem Anti-sis-verwandten-Polypeptid-Serum enthalten waren. Wie erwartet, wurde nur unspezifisches Binden durch die oligokionalen, gegen das myb-verwandte Polypeptid, Polypeptid (d), gezogenen Rezeptoren gezeigt (Spuren und 5).

Unter der Annahme, daß die Aminosäurerest-Sequenzen von PDGF-1 und -2 kolinear mit der Sequenz von p28sis sind, entspricht die Aminosäurerest-Sequenz des Polypeptids (c) den Positionen 67 bis 83 bzw. 73 bis 89 von PDGF-1 bzw. -2. Die Aminosäurerest-Sequenz der Reste 73 bis 80 von PDGF-2 wurde bestimmt [Doolittle et al., Science 221: 275-277 (1983)], und alle von diesen Resten sind mit den ersten (aminoterminalen) acht Resten des Polypeptids (c) identisch. Darüber hinaus wurde ein Polypeptid von PDGF, den Resten 147 bis 155 des Onkoproteins p28sis entsprechend, sequenziert [Waterfield, Nature 304: 35-39 (1983)], und von den bisher identifizierten neun Resten sind alle mit den entsprechenden Resten des Poly peptids (c) identisch. Daher sind sechzehn der siebzehn Reste des Polypeptids (c) identisch mit und in derselben Sequenz wie Reste sowohl in PDGF, welches von Menschen stammt, als auch in p28sis, welches von einer Linie von mit einem Retrovirus transformierten Zellen abstammt.

Die obenstehenden Ergebnisse erläutern daher die Immunogenität und Antigenität von zwei zusätzlichen Polypeptiden, die nützlich für Immunisierungen sind, welche zu der Herstellung von Hybridomen führen, die monokonale Rezeptoren dieser Erfindung sezernieren. Diese Ergebnisse zeigen ebenfalls, daß die oligokionalen, gegen das Polypeptid (c) erzeugten Rezeptoren auch an ein Onkoprotein binden; d.h. PDGF, PDGF-1 und PDGF-2.

Zusätzliche synthetische Polypeptide, die verschiedene Bereiche beider Sequenzen von PDGF reprasentieren, wurden hergestellt. Die Aminoenden von PDGF-1 und PDGF-2, sowie der zentrale und der carboxyterminale Teil von PDGF-2 wurden synthetisiert, mit dem immunogenen Träger, dem Hämocyanin der Schlüssellochnapfschnecke (KLH), konjugiert und in Mäuse injiziert, um die Erzeugung oligoklonalen Rezeptor enthaltender Antiseren zu induzieren, welche den zuvor beschriebenen Soprozentigen Bindungstiter aufwiesen.

Das den allein dem PDGF-2 eigenen Bereich repräsentierende Polypeptid enthält die ersten 18 Aminosaurereste dieser Sequenz und wird PDGF-2 (1-18) (Polypeptid Nummer 112) genannt, wobei die Zahlen in Klammern die Aminosäurereste des entsprechenden Moleküls, nummeriert vom Aminoende her, anzeigen. Der allein dem PDGF-1 eigene Bereich wird durch ein Polypeptid PDGF-1 (1-12) repräsentiert, welches auch als Polypeptid Nummer 111 bezeichnet wird, welches die ersten 12 Aminosauren dieser Sequenz enthält. Sechs von diesen 12 Aminosauren werden mit PDGF-2 geteilt, aber nur drei sind aufeinanderfolgend, wie vorstehend bemerkt. Das dritte Polypeptid, PDGF-2 (73-89), wird hierin auch als Polypeptid (c) und Polypeptid Nummer 113 bezeichnet. Es repräsentiert die vorausgesagten Aminosäurereste 139-155 von p28sis und enthält ein zusätzliches Cystein für Kopplungszwecke an seinem Carboxyende. Dieses Polypeptid induziert, wenn es mit KLH gekoppelt ist, die Herstellung von Antikörpern, die die reduzierten Untereinheiten von gereinigtem PDGF, Proteine von einem Molekulargewicht von 31 000, 30 000, 21 000 und 18 000-14 000 in einem Blutplättchenextrakt und ein 56 kD großes Protein in mit SSV infizierten Zellen des Krallenaffen erkennen. Das vierte Polypeptid, PDGF-2 (126-145) wurde ebenfalls durch die Sequenz von v- sis vorausgesagt (Reste 191-210 von p28sis, auch als Polypeptid 114 bezeichnet). Die Aminosäuresequenzen dieser Polypeptide wurden hierin vorstehend erläutert.

Um die Spezifität der oligoklonalen Rezeptor enthaltenden Antiseren, die gegen diese synthetischen Polypeptidkonjugate erzeugt worden waren, zu analysieren, wurde PDGF mit diesen Antiseren sondiert. Gereinigtes PDGF wurde reduziert und in einem Polyacrylamidgel elektrophoretisch behandelt und dann unter Verwendung eines Western-Blot-Verfahrens auf Nitrozellulose gebracht (Figur 6, Spuren A bis F). In den Spuren A und B gingen zwei gegen PDGF- 1(1-12) gerichtete Antiseren eine Immunreaktion mit einem Protein von etwa 18 000 Dalton ein. Die Sequenzanalyse des gereinigten PDGF zeigt an, daß der Großteil der PDGF-1- Kette zu dieser Position wandert [Antonaides et al., Science 220: 963-965 (1983)]. Die Schwäche der Reaktion mit diesen Antiseren legt nahe, daß das aminoterminale Ende von PDGF-1 für eine Antikörperbindung nicht leicht zugänglich ist.

Im Gegensatz dazu wies ein gegen das Aminoende von PDGF-2 (1-18) gerichtetes Antiserum (Spur C) leicht ein Protein nach, welches bei etwa 18 000 und 14 000 Dalton wanderte, in Übereinstimmung mit der Sequenzanalyse von PDGF-2 (Antonaides et al., siehe oben).

Die durch PDGF-2 (73-89) induzierten Antiseren erzeugten dieselben Aktivitäten (Spuren D, E), wie die in Spur C ersichtlichen. Im Gegensatz dazu wiesen Antiseren gegen PDGF-2 (126- 145) keine nachweisbare Aktivität gegen gereinigtes PDGF auf.

Da die Sequenz des Polypeptids PDGF-2 (126-145) von c-PDGF an der Position 145 abweicht (Josephs, et al., siehe oben), ist es möglich, daß dieser Austausch eines Aminosäurerests in der Epitopstelle enthalten ist. Dies ist unwahrscheinlich, weil das Polypeptid zwanzig Aminosaurereste lang ist und der Austausch nur an der carboxyterminalen Position liegt, die verwendet wird, um das Polypeptid an das Trägerprotein KLH zu koppeln. Der Mangel an Aktivität ist daher nicht auf die Erzeugung von für das Onkopolypeptid spezifischen Antikörpern zurückzuführen, weil dieses Antiserum mit von Zellen abstammenden PDGF-artigen Molekülen reagiert. Die Größe von 14 000 bis 18 000 Dalton des in gereinigten Präparationen nachgewiesenen PDGF legt nahe, daß dem meisten von diesem Material das carboxyterminale Ende der vorausgesagten Sequenz von p28sis fehlt, was die gesamte oder einen Teil der durch dieses Antiserum erkannten antigenen Stelle von PDGF entfernen wurde.

Um zu bestimmen, ob PDGF-artige Proteine auch in anderen transformierten Zellinien synthetisiert werden könnten, wurden Extrakte hergestellt und mit verschiedenen oligoklonalen Rezeptor enthaltenden Antiseren gegen PDGF-verwandte Polypeptide zur Immunreaktion gebracht. In der Figur 7 wurden die mit SSV transformierten NIH-3T3-Zellen mit einem oligoklonalen Rezeptor enthaltenden Antiserum, induziert durch PDGF-1 (1-12) (Spuren A-C, F-H und K-M) und durch PDGF-2 (73-89) (Spuren D, E, I, J, N und O), sondiert. Von den zwei Seren gegen PDGF-2 (73-89) (Figur 6, Spuren D und E) erzeugte das in der Figur 6, Spur D, verwendete Serum mit gereinigtem PDGF eine etwas schwächere Aktivität. Wie jedoch in der Spur D von Figur 7 ersichtlich ist, wurde eine starke Reaktivität mit einem Protein von etwa 70 000 Dalton beobachtet, die durch eine Vorinkubation mit dem immunisierenden Polypeptid, PDGF-2 (73-89), blockiert wurde (Spur E), aber nicht durch eine Vorinkubation des Antiserums mit PDGF-1 (1-12) blockiert wurde.

Daher zeigt die spezifische Reaktivität von beiden Antiseren mit diesen Onkoproteinen, daß dies keine zufällige Kreuzreaktivität mit einem kleinen Bereich von PDGF ist, sondern daß dieses Molekül Sequenzen enthält, die homolog sind zu wenigstens dem Aminoende von PDGF-1 und dem zentralen Bereich von PDGF-2. Die Mengen von p28sis und p20sis waren unterhalb der Nachweisschwelle mit diesem Anti-PDGF-2(73-89)-Serum. Annliche Ergebnisse wurden mit zusätzlichen Antiseren erhalten, obwohl eine Überexposition zuweilen zeigte, daß eine Bande von 20 000 Dalton spezifisch nachgewiesen wurde (Daten nicht gezeigt).

Die Analyse der Extrakte von zwei anderen, nicht verwandten transformierten Zellen mit diesen Antiseren ergab ähnliche Resultate. Die Zellinie TRD1 ist eine spontan transformierte Balb/3T3-Zellinie et al., Proc. Natl Acad. Sci. USA 81: 2 396-2 400 (1984)]. Diese Linie exprimiert auch ein Protein von 70 000 Dalton sowie ein mehr immunologisch verwandtes Protein von etwa 100 000 Dalton (Figur 7, Spuren G-I). Eine dritte Zellinie, MSTF, und eine Nerz-Lungen-Linie (CCL64), die mit FeLV-B und dem Snyder-Theilen- Stamm von FeSV produktiv infiziert ist, exprimieren ebenfalls das Protein derselben Größe (Figur 7, Spuren K-O).

Zusätzlich zu dem Onkoprotein von 70 000 Dalton wies ein oligoklonalen Rezeptor enthaltendes Antiserum gegen PDGF-1(1-12) Proteine von etwa 53 000 Dalton nach (Daten nicht gezeigt). Diese Proteine sind keine Serumkontaminanten, weil sie in Extrakten von Zellen nachgewiesen werden, welche einen Monat lang in Abwesenheit von Serum gewachsen sind und in den serumfreien Medien, die von den TRD1 -Zellinien konditioniert wurden, gefünden werden. Alle untersuchten Zellinien enthalten diese zwei PDGF-artigen Proteine. (Siehe ebenfalls Diskussion der Figur 11 in "Kurze Beschreibung der Figuren").

Die Expression der PDGF-artigen Moleküle in einem breiten Spektrum von Zellen, einschließlich von Zellen, die nicht onkogen transformiert sind (normale diploide glatte Muskelzellen der Ratte und normale humane Lungenfibroblasten) zeigt an, daß andere Prozesse an der Transformation beteiligt sind. Obwohl alle Zellinien die mit oligoklonalen Rezeptor enthaltenden, durch PDGF- 1(1-12) induzierten, Antiseren nachgewiesenen Proteine von 70 000 und 53 000 Dalton enthielten, waren die Zellen bezüglich der Größe und Intensität anderer Proteine, die mit dem gegen die Determinanten, die durch die Sequenz des Bereichs von PDGF-2 vorausgesagt wurden, gerichteten Antiserum nachgewiesen wurden ziemlich heterogen (Daten nicht gezeigt). Die Natur dieser Unterschiede ist gegenwärtig unbekannt.

In einer ähnlichen Weise kann ein jedes der vier immunogenen, nachstehend als (e-h) bezeichneten Polypeptide verwendet werden, um oligoklonale Rezeptoren zu induzieren, welche an diese immunogenen Polypeptide, welche verwendet wurden, um ihre Produktion zu induzieren, sowie an jedes der zwei, von dem Onkogen ras codierten Onkoproteine binden. Die Sequenzen dieser vier ras-verwandten Polypeptide in der Richtung von links nach rechts und vom Aminoende zum Carboxyende werden dargestellt durch die Formeln:

Polypeptid e KLVVVGARGVGK (Polypeptid 141)

Polypeptid f KLVVVGASGVGK (Polypeptid 143)

Polypeptid g KLVVVGAVGVGK (Polypeptid 144)

Polypeptid h KLVVVGAGGVGK (Polypeptid 145)

oder durch die kombinierte Formel:

Polypeptid (e-h)

KLVVVGAR(S, V, G)GVGK;

worin die Aminosäurereste in Klammern jeweils eine Alternative zu dem in der Formel direkt vorausgehenden Äminosäurerest, sind. Die so erzeugten oligoklonalen Rezeptoren haben eine 50-prozentige Bindungstiter-Verdünnung von mehr als 1:400 nach zwei Immunisierungen, wie vorstehend beschrieben, in einem Zeitraum von etwa einem Monat. Zusätzlich wurde gezeigt, daß jeder ras-verwandte oligokionale Rezeptor, der durch die Polypeptide (e), (f) und (h) induziert wurde, an ein Onkoprotein, welches in lysierten Zellextrakten aus (a) den humanen Blasenkarzimomzellen T24 und ebenso (b) Mäuse-3T3-Zellen, infiziert mit dem Harvey- Mäuse-Sarkom-Virus vorhanden ist, bindet (Daten nicht gezeigt).

Wie in der Figur 12 ersichtlich ist, kann jedes der zwei nachstehend benannten immunogenen Polypeptide (k und 1) verwendet werden, um oligoklonale Rezeptoren zu induzieren, die an diese immunogenen Polypeptide binden, die verwendet wurden, um ihre Erzeugung zu induzieren, sowie an jedes von zwei Onkoproteinen, die von dem Onkogen v-fes codiert werden. Die Sequenzen der zwei v-fes-verwandten Polypeptide werden dargestellt in der Richtung von links nach rechts und vom Aminoende zum Carboxyende durch die Formel:

Polypeptid k LMEQCWAYEPGQRPSF

(Polypeptid 127);

Polypeptid 1 IGRGNFGEVFSG

(Polypeptid 121).

Man hat gezeigt, daß die oligokionalen, durch die Polypeptide (k) und (1) induzierten Rezeptoren an ein Onkoprotein, das im Überstand von Zellen des humanen Blasenkarzinoms T24 und einer spontan transformierten Mäuse-3T3-Zellinie vorhanden ist, binden (Spuren A und C).

Es wurde gezeigt, daß die, von den Hybridomen ATCC HB 8952, HB 8954 und HB 8955, gezogen gegen das Polypeptid 121, sezernierten monoklonalen Rezeptoren mit einem oder mehreren, aus Tumoren der Brust, des Rectums, des Magens und des Endometriums erhaltenen Proteinen eine Immunreaktion eingehen. Die Reaktivität eines gegen das Polypeptid 127 gezogenen monokionalen Rezeptors (Hybridom 1 27-42C11) mit Proteinen in Urinproben schwangerer Mütter wurde beobachtet.

Wie in der Figur 13 gezeigt, wurde ein mit dem Onkogen ras verwandtes Protein durch einen monoklonalen Antikörper nachgewiesen (aus dem Hybridom ATCC HB 8679), gezogen gegen ein synthetisches ras-Peptid, den Positionen 96-118 von v-rasHa entsprechend (Polypeptid 142). Das Protein wird in der Spur A nachgewiesen und durch eine Vorinkubation mit dem immunisierenden Peptid blockiert (Spur B). Daher blockierte die Vorinkubation mit dem immunisierenden Polypeptid das stark reaktive Onkoprotein.

Die Verwendungmonoklonaler Rezeptoren, wie hier vorstehend beschrieben, wie denjenigen, die gegen das sis(PDGF)-verwandte Polypeptid (c) oder gegen diefts-verwandten Polypeptide (a), (b), (k) oder (1) oder gegen die ras-verwandten Polypeptide (e-h) oder gegen die anderen Onkoprotein-verwandten Polypeptide, die hier beschrieben sind, herangezogen wurden, in den Affinitätssorptionsmitteln, die nachstehend beschrieben werden, stellt ein bequemes und weniger mühsames Mittel zur Herstellung natürlich auftretender proteinartiger Materialien bereit, die sonst schwer in gereinigter Form zu erhalten wären, wie PDGF. Daher kann man, statt daß man durch das lange Verfahren, um gereinigtes PDGF zu erhalten, gehen muß, wie hier nachstehend besprochen, zum Beispiel nur die Zellen lysieren, zentrifügieren, den Überstand durch eine Affinitätssorptionssäule, die gebundenen Anti-Polypeptid-(c)-Rezeptor enthält, gießen und das gereinigte Protein nach der Dissoziierung des gebildeten reversiblen Ligandenkomplexes, eluieren. Während einige zusätzliche proteinartige Materialien in unspezifischer Weise an die Atfinitätssorptionssäule gebunden sein können, wird die Isolierung gereinigter Proteine, die sonst schwer in einer solchen Form zu erhalten wären, unter Verwendung solcher Sorptionsmittel stark verbessert.

Die Antiseren gegen die oben beschriebenen konservierten Sequenzen reagieren mit Proteinen in einer weiten Vielzahl transformierter Zellinien. Die Antiseren wiesen leicht Onkogenverwandte Proteine nach, die in dem Urin von Krebspatienten und von schwangeren Frauen fünf- bis fünfzigfach höher konzentriert waren als bei normalen Kontrollen. Einzigartige Expressionsmuster wurden bei verschiedenen bösartigen Erkrankungen und während verschiedenen Schwangerschaftszuständen während der Schwangerschaft nachgewiesen.

Anti-Peptid-Antikörper sind in besonderer Weise zum Nachweis von Proteinen, die immunologisch mit sequenzierten Onkogenen verwandt sind, geeignet [Wong et al., Proc. Natl. Acad. Sci. USA 78: 7 412-7 416 (1981)]. Da sie sequenzspezifisch sind, können Anti-Peptid- Antikörper gegen in hohem Maße konservierte Bereiche von Proteinen gerichtet sein, um die Wahrscheinlichkeit der Identifizierung verwandter Moleküle, welche ähnliche Funktionen haben können, zu maxinueren. Da die Immunerkennung von Proteinen durch Anti-Peptid- Antikörper nicht in hohem Maße von der Konformation des Antigens abhängig sein muß, kann man Proteine angeben, die nicht durch Anti-Protein-Antikörper nachgewiesen werden, von denen der Großteil gegen Determinanten, die nur dem gefalteten Protein eigen sind, gerichtet ist. Schließlich ist die Bindung von Anti-Peptid-Antikörpern gegenüber einer Veränderung oder Fragmentierung des Zielantigens, wie sie in Körpertlüssigkeiten oder Sekreten auftreten mag, relativ unempfindlich.

In den Tabellen 1 und 3 sind die synthetischen Peptide, die verwendet wurden, um die Antikörper zu erzeugen, nummeriert und zusammen mit den verwandten Sequenzen anderer Onkogene aufgelistet. Bei einem exemplarischen ras-Polypeptid 142 handelt es sich um die Sequenz v-rasHa, lokalisiert 37-59 Aminosäuren stromabwärts vom Threoninrest, der durch p21, codiert von v-rasHa oder v-rasKi, autophosphoryliert wird. Die Sequenz ist in H-RAS und N-RAS identisch und weicht von K-RAS durch einen konservativen Aminosäureaustausch ab [Capon et al., Nature 304: 507 (1983)]. Die Sequenz von PDGF-2, die verwendet wurde, um die monokionalen sis-Antikörper zu erzeugen, ist am Aminoende der Kette (Polypeptid 112) lokalisiert und ist mit den ersten 12 Aminosauren der anderen Kette (PDGF-1) des von Blutplättchen abgeleiteten Wachstumsfaktors homolog. Das fes-Peptid (Polypeptid 127) macht die Reste 744-759 des 85 000 Dalton großen Fusionsproteins von v-fes-st (Positionen 927-942 von v-fes-GA) aus und liegt 79-94 Aminosauren stromabwärts von der hauptsächlichen Tyrosin-Phosphorylierungsstelle. Die für diese Untersuchung verwendeten Peptide wurde ausgewählt, weil sie hoch-konservierte Bereiche der jeweiligen Onkogenfamilien repräsentieren.

Die Antiseren gegen diese konservierten Sequenzen reagieren mit Proteinen in einer breiten Vielzahl transformierter Zellinien. Die Reaktivität der drei Antiseren mit Proteinen einer durch das Katzen-Sarkom-Virus transformierten Nerz-Lungenlinie ist in der Figur 14 gezeigt. Antikörper gegen das sis-Peptid detektieren ein Protein von 20 000 Dalton in SSV-transformierten NRK-Zellen sowie ein sis-verwandtes Protein von etwa 56 000 Dalton (p56sis) in der Nerz-Lungenlinie (Spur 1). Antikörper gegen das ras-Peptid detektieren ein Hauptprotein von etwa 21 000 Dalton (p21ras) und ein weniger bedeutendes Protein von etwa 30 000 Dalton in dem Zellextrakt (Spur 2). Das Antiserum gegen das fes-Protein weist das 85 000 Dalton große gag-fes-Fusionsprotein (pp85-gag-fes) sowie ein Protein von 40 000 Dalton (p40fes, Spur 3) nach.

In der Figur 15 wird die Reaktivität dieser Antiseren mit Urinproteinen aus einer Vielzahl von Patienten gezeigt. Die sis-Antiseren detektieren Proteine von 56 000, 31 000 und 25 000 Dalton in Urinkonzentraten (Bilddarstellung A).

Das Binden von Antikörpern an alle drei Proteine wird durch eine vorausgehende Inkübation mit dem sis-Peptid (Bilddarstellung B), nicht aber durch eine Inkubation mit dem ras-Peptid (Bilddarstellung A) blockiert. Die Konzentrationen der nachgewiesenen Proteine sind fünf- bis fünfzigfach höher als in normalen Individuen (siehe unten). Alle untersuchten Urine enthielten die drei sis-verwandten Proteine, außer der Probe von dem Patienten mit einem Lymphom, in der das Protein von 56 000 Dalton fehlt (Spur 4).

Die etwas schnellere Mobilität von p56sis (Bilddarstellung A, Spuren 1 und 2) in dem Urin von Spendern mit multiplem Myelom und Magenkrebs, ist auf überschüssiges Albumin in diesen Proben zurückzuführen, wohingegen die Verzerrung der Proteine mit niedrigerem Molekular gewicht in der Spur 1 auf überschüssige Mengen der leichten Kette des Antikörpers zurückzuführen ist.

In Bilddarstellung C sind die verschiedenen ras-verwandten Proteine, die in Urinproben nachgewiesen wurden, gezeigt. Proteine von etwa 100 000 und 55 000 Dalton werden nachgewiesen (Buddarstellung C, Spuren 2-4). Wiederum wurde die Spezifität des Antiserums durch das Blockieren der Aktivität durch eine Vorinkubation mit dem ras-Peptid (Bilddarstellung D), jedoch nicht durch eine Vorinkubation mit dem sis-Peptid (Bilddarstellung C), gezeigt.

Das ras-verwandte Protein von 55 000 Dalton ist von dem sis-verwandten Protein von 56 000 Dalton verschieden (siehe unten) und zeigt bei jeder Probe unterschiedliche Reaktivitätsmuster. Das Protein ist in Bilddarstellung C, Spur 1 (Magenkrebs) nicht detektierbar, während vier Banden von fast gleicher Intensität in der Spur 2 (38 Wochen schwanger) beobachtet werden.

Eine stark reaktive Doppelbande wird in der Spur 3 sichtbar gemacht, wenn Urin von einem Patienten (Spender) mit Brustkrebs sondiert wurde. Eine weniger bedeutende Bande bei etwa 35 000 Dalton ist mit hohen Konzentrationen des 55 000 Dalton großen Proteins assoziiert. In der Spur 4 wurde eine einzelne Bande von 55 000 Dalton nachgewiesen.

Proteine von etwa 21 000 Dalton wurden in allen vier Spuren von Bilddarstellung C nachgewiesen. Diese kleineren Proteine waren in ähnlichen Konzentrationen vorhanden, obwohl die Mobilität des Proteins in Bilddarstellung C, Spur 1 geringfügig langsamer ist. Diese veränderte Mobilität kann aufgrund der Auswirkung von Austauschen an der Aminosäurerestposition 12 auf die elektrophoretische Mobilität von ras-codierten Proteinen signifikant sein. Die bei 25 000 Dalton nachgewiesene Bindung ist aufgrund ihrer Comigration mit der leichten Kette des Antikörpers schwierig zu interpretieren.

In Bilddarstellung E sind diefes-verwandten Proteine von 35 000 und 40 000 Dalton gezeigt. Die Bindung wurde durch Vorihkubation mit dem immunisierendenfes-Peptid (Bilddarstellung E, Spur 1) blockiert, nicht aber durch eine Inkubation mit dem ras-Peptid oder Peptiden, die die homologen Sequenzen in den Proteinen erbB oder abl repräsentieren (Bilddarstellung E, Spuren 2-4).

Zusammengefaßt detektieren die obenstehend beschriebenen 3 Antiseren in spezifischer Weise 8 verschiedene Proteine im Urin, 3 sis-verwandte Proteine (p56sis, p31sis und p25sis), 3 ras- verwandte Proteine (p100ras, p55ras und p21ras) und 2fes-verwandte Proteine (p40fes, p35fes).

In der Figur 23 sind die Häufigkeiten des Nachweises von Onkogen-verwandten Proteinen in Urinproben der 51 Kontroll- (normal, frei von einer diagnostizierten neoplastischen Erkrankung) oder 189 Urinproben von Patienten (Spendern) mit einer Vielzahl von bösartigen Erkrankungen aufgelistet. Annliche Häufigkeiten in 260 Urinproben von schwangeren Frauen sind in der Figur 24 gezeigt. Die Menge Onkogen-verwandter Proteine in dem Urin wurde unter Verwendung von Immunoblots abgeschätzt und wurde in eine von vier Kategorien eingeteilt: nicht detektierbar, detektierbar, 5-15fach erhöht und mehr als 15fach erhöht.

Die Typen der bösartigen Erkrahkungen, in welchen mehr als 10 Proben getestet wurden, sind einzeln aufgelistet. Die verbleibenden Arten sind als Verbund aufgelistet.

p21ras wurde in etwa 70 % aller Tumorproben nachgewiesen. Es wurden jedoch ännliche Häufigkeiten in offensichtlich normalen Individuen gefünden Im Gegensatz zu den erhöhten Spiegeln der ras- und fes-verwandten Proteine, die im Urin von Brustkrebspatienten gefünden wurden, sezernieren Patienten mit Blasen- und Prostatakrebs häufig erhöhte Spiegel des 56 000 Dalton großen sis-verwandten Proteins. Dieses Protein wurde in Abwesenheit der oben beschriebenen ras- und fes-verwandten Proteine nachgewiesen (Figur 15, Spuren 1, 2, Bilddarstellungsfelder A-C). Zusätzlich zu dem sis-verwandten Protein von 56 000 hatten diese Patienten häufig erhöhte Spiegel der sis-verwandten Proteine von 31 000 und/oder 25 000 Dalton. Ebenfalls im Gegensatz dazu enthielt der Urin eines Patienten mit einem gutartigen Prostataknötchen keine erhöhten Spiegel dieser Onkogen-verwandten Proteine (Figur 18, Spur 3, Bilddarstellung A-C).

Höhere Spiegel der kleineren Proteine wurden ebenfalls häufig im Urin von Patienten mit Lungen- und Cervixkrebs sowie Non-Hodgkin-Lymphomen gefünden (siehe Figur 23). In -diesen zuletztgenannten Patienten wurden die erhöhten, sis-verwandten Proteine von 31 000 und/oder 25 000 in Abwesenheit des Proteins von 56 000 Dalton gefünden (Figur 5, Spur 4, Bilddarstellung A-B).

Daher wurden in den Urinproben von Krebspatienten drei ungewöhnliche Muster beobachtet. Eine Untergruppe der Brustkrebspatienten hat erhöhte Spiegel von pssras in Verbindung mit p40fes und/oder p35fes Patienten mit Blasen- und Prostatakrebs scheiden erhöhte Mengen aller drei sis-verwandten Proteine in Abwesenheit von pssras, P55ras und p35fes aus. Schließlich scheidet eine Untergruppe von Lungenkrebs- und Lymphompatienten erhöhte Spiegel von lediglich den sis-verwandten Proteinen mit den geringeren Molekulargewichtsgrößen aus. Wie aus den Figuren 15-18, sowie aus der Figur 23 ersehen werden kann, korrelieren die Expressionsmuster mit den Zuständen der Erkrahkung besser als die Ausscheidung von hohen Spiegeln eines einzelnen Onkogen-verwandten Proteins. Bei offensichtlich normalen Individuen werden erhöhte Spiegel dieser Proteine selten nachgewiesen.

Die hierin beschriebenen Proteine sind immunologisch mit Onkogenproteinen verwandt, basierend auf der hochspezifischen Reaktivität der verschiedenen Anti-Peptid-Antiseren. Von den acht beschriebenen Proteinen repräsentieren jedoch nur zwei (p21ras und p31sis) von Onkogenen codierte Gesamt-Proteine.

Das Protein p21ras hat eine GTP bindende Aktivität. Daher ist p21ras eng an der Zellteilung beteiligt, und deshalb ist es nicht überraschend, daß das Protein leicht in den meisten Urinproben nachgewiesen wird.

In ähnlicher Weise wurden erhöhte Spiegel von Trariskripten, die spezifisch sind für H-ras oder K-ras, in einer breiten Vielzahl von bösartigen Erkrahkungen nachgewiesen, wie hierin gezeigt wird. Des weiteren haben Antiseren gegen ras-verwandte Produkte ebenfalls eine erhöhte Expression in Tumorgeweben nachgewiesen. Hier wurde die augenfalligste Erhöhung dieses Proteins im Urin bei bösartigen Erkrankungen gefünden.

Das Protein p31sis, welches eine der Ketten des von Blutplättchen abgeleiteten Wachstumsfaktors (PDGF) ist, wurde ebenfalls nachgewiesen. Obwohl die Kette von PDGF- 1 nur 18 000 Dalton groß ist, wenn sie aus Blutplättchen isoliert wird, zeigt der Vergleich der Sequenz von humanem c-sis mit v-sis, daß das 18 000 Dalton große Protein von einem größeren Vorläuferprotein abstammt. In der Tat enthüllt die Analyse eines partiell gereinigten Blutplättchenextraktes ein Protein von etwa 31 000 Dalton. Da PDGF eine starke mitogene Aktivität hat und von Blutplättchen am Ort von Gewebsverletzungen freigesetzt wird, denkt man, daß eine der physiologischen Funktionen von PDGF in der Wundheilung besteht. Darüber hinaus wird PDGF-artiges Material von einer Anzahl transformierter Zellinien sezerniert und die Sekretion scheint in Zellen des glatten Muskels entwicklungsbedingt reguliert zu sein. Daher kann p31sis wie p21ras physiologisch wichtig sein, und es ist nicht überraschend, daß es im Urin bei normalen und abnormalen Zuständen vorhanden ist.

Zusätzlich zu den von dem Onkogen codierten Proteinen der erwarteten molekularen Größe wurden in dieser Untersuchung zusätzliche Proteine nachgewiesen. Es ist nicht wahrscheinlich, daß ihre Anwesenheit auffalsche Kreuzreaktivitäten zurückzuführen ist, da sie einzig bei bestimmten Krebsarten sowie während der Schwangerschaft vorhanden sind. Des weiteren wurde die Reaktion der Antikörper mit diesen Proteinen in spezifischer Weise mit den passenden synthetischen Immunogenen inhibiert. Da die als Immunogene verwendeten Peptide konservierte Sequenzen zwischen den Onkogenfamilien reprasentieren, können diese zusätzlichen Proteine Mitglieder dieser Genfamilien reprasentieren. Die Expression dieser Gene kann während einer Neoplasie oder einer Schwangerschaft unter eine koordinierte Regulierung geraten. Unabhängig vom Ursprung dieser Proteine macht sie die Tatsache, daß sie einzig wänrend einer Neoplasie und einer Schwangerschaft exprimiert werden, zu wichtigen Markern.

III. Kits

Wie hier vorstehend angedeutet, bilden Kits für die Durchführung eines Verfahrens der Erfindung einen anderen Aspekt der Erfindung. Ein solches Kit schließt wenigstens eine Packung ein, die biologisch aktive, monoklonale Rezeptormoleküle enthält. Jeder solche monoklonale Rezeptor bindet an

(a) ein Polypeptid, enthaltend etwa 7 bis etwa 40 und bevorzugtermaßen etwa 10 bis etwa 30 Aminosaurereste in einer Aminosäurerest-Sequenz, die einem Teil der Aminosäurerest- Sequenz eines Onkoproteinliganden, codiert von einem Gen eines Retrovirus, entspücht, und

(b) den von einem retroviralen Gen codierten Onkoproteinliganden.

Wenn eine vorbestimmte Menge der monoklonalen Rezeptormoleküle mit einer vorbestimmten Menge einer einen Onkoproteinliganden enthaltenden, wäßrigen Zusammensetzung vermischt wird, tritt eine immunologische Reaktion auf, die einen Komplex zwischen dem Rezeptor und dem Liganden bildet (Antikörper und Antigen). Exemplarische, waßrige, ein Onkoprotein enthaltende Zusammensetzungen schließen, ohne Beschrankung, Zellysate, Serum, Plasma, Urin und Amnionflüssigkeit ein.

Ein Kit der Erfindung wird verwendet, um mit Antiseren nach mehr als einem Onkogen-verwandten Translationsprodukt zu screenen. Daher können die hier dargestellten Assayverfahren an einer Gruppe von Aliquots von Körpertlüssigkeitsproben durchgeführt werden, die von einem einzelnen Spender entnommen wurden, um eine genaue Information bezüglich der therapeutischen Behandlung eines neoplastischen Zustandes zu erhalten.

Das Vermischen von einem Rezeptor mit einem Liganden findet in einer wäßrigen Zusammensetzung statt. Es können jedoch entweder der Rezeptor oder der Ligand vor dieser Vermischung im wesentlichen trocken und wasserfrei sein. Daher kann eine Lösung des Rezeptors in einem Überstand eines Hybridoms, in Aszitesflüssigkeit oder in einem Puffer mit einem wäßrigen Zellextrakt versetzt werden, um die Reagenzien von zwei wäßrigen Zusammensetzungen miteinander zu vermischen. Die Wände einer Mikrotiterplatte können mit dem Rezeptor beschichtet sein, und er kann dann mit einem den Liganden enthaltenden Zellextrakt oder Serum vermischt werden; oder der Ligand kann auf die Wände einer Mikrotiterplatte, ein Nitrozelluloseblatt nach einem Transfer von einem Acrylamidgel, oder dergleichen, aufbeschichtet sein, oder er kann in einem Gewebeschnitt vorhanden sein, und der Überstand eines Hybridoms, Aszitesflüssigkeit oder eine den Rezeptor enthaltende Pufferlösung kann hinzugemischt werden.

Bezugnehmend auf die Beschreibungen der Figuren werden Onkoproteinliganden, die auf Nitrozellulose aufbeschichtet wurden und die dann mit einem monokionalen Rezeptor versetzt wurden, in Hinblick auf die Figuren 1, 2, 5-8 und 11-14 besprochen, während ein mit einem Hybridomüberstand, um einen immunologischen Komplex zu bilden, inkubierter Zellextrakt in Hinsicht auf die Figur 3 besprochen wird. Die Onkoproteine aus Urinproben werden in den Figuren 9, 10 und 15-19 erörtert;

Die Rezeptoren werden gemeinsam mit einer "anzeigenden Gruppe" oder einer "Markierung" verwendet. Die anzeigende Gruppe oder die Markierung wird in Verbindung mit dem Rezeptor als ein Mittel verwendet, um zu bestimmen, ob eine Immunreaktion stattgefilnden hat und ein immunologischer Komplex gebildet wurde, und in einigen Fällen zur Bestimmung des Ausmaßes einer solchen Reaktion.

Bei der anzeigenden Gruppe kann es sich um ein einzelnes Atom, wie in den Fällen radioaktiver Elemente, wie bd 125 oder 131, Wasserstoff 3, Schwefel 35, Kohlenstoff 14, oder NMR-aktiver Elemente, wie Fluor 19 oder Stickstoff 15, handeln. Die anzeigende Gruppe kann auch ein Molekül wie ein Fluoreszenzfarbstoff, wie Fluorescein, Rhodamin B, oder ein Enzym, wie Meerrettichperoxidase (HRP) oder Glucoseoxidase oder dergleichen sein.

Die anzeigende Gruppe kann an den Rezeptor gebunden sein, wie dann, wenn ein Antikörper mit 125I markiert ist. Die anzeigende Gruppe kann auch das ganze oder einen Teil eines getrennten Moleküls oder Atoms bilden, das mit dem Rezeptormolekül reagiert, wie ein HRP- verknüpfter Rezeptor, der in einer Maus herangezogen wurde oder wenn ein radioaktives Element wie 125I an das von Staphylococcus aureus erhaltene Protein A gebunden ist.

-Wo die haupsächliche anzeigende Gruppe ein Enzym, wie HRP oder Glucoseoxidase, ist, sind zusätzliche Reagenzien erforderlich, um die Tatsache sichtbar zu machen, daß eine Immunreaktion aufgetreten ist und sich der Rezeptor-Liganden-Komplex gebildet hat. Solche zusätzlichen Reagenzien schließen für HRP Wasserstoftperoxid und einen Vorläufer eines Oxidationsfarbstoffs, wie Diaminobenzidin, ein. Zusätzliche Reagenzien, die nützlich bei Glucoseoxidase sind, schließen ABTS-Farbstoff, Glucose und HRP ein.

Die Begriffe "anzeigende Gruppe" oder "Markierung" werden hierin verwendet, um einzelne Atome oder Moleküle einzuschließen, die mit dem Rezeptor verknüpft sind oder getrennt verwendet werden, sei es daß diese Atome und Moleküle alleine oder in Verbindung mit zusätzlichen Reagenzien verwendet werden. Solche anzeigenden Gruppen oder Markierungen sind in der Immunchemie selbst gut bekannt und bilden einen Teil dieser Erfindung nur insoweit, als sie mit ansonsten neuen Rezeptoren, Verfähren und/oder Systemen verwendet werden.

Eine anzeigende Gruppe oder eine Markierung wird bevorzugtermaßen gemeinsam mit dem Rezeptor geliefert und kann damit zusammen verpackt sein oder getrennt verpackt sein. Zusätzliche Reagenzien, wie Wasserstoffperoxid und Diaminobenzidin, können ebenfalls in dem System eingeschlossen sein, falls eine anzeigende Gruppe wie HRP verwendet wird. Solche Materialien sind leicht im Handel erhältlich, so wie viele anzeigende Gruppen, und müssen nicht gemeinsam mit dem diagnostischen System geliefert werden. Darüber hinaus zersetzen sich einige Reagenzien, wie Wasserstoffperoxid, bei Aufbewahrung oder sind in anderer Weise kurzlebig, wie einige radioaktive Elemente, und werden deshalb besser von dem Endverbraucher bereitgestellt.

Ein Kit der Erfindung kann ebenfalls eine feste Matrix einschließen, die eine 96-Vertiefüngs- Mikrotiterplatte, vertrieben unter der Bezeichnung Immulon II (Dynatech, Alexandria, VA) sein kann. Der Mikrotiterstreifen oder die -platte ist aus einem klaren Plastikmaterial hergestellt, bevorzugtermaßen Polyvinylchlorid oder Polystyrol. Alternative feste Matrizes zur Verwendung in einem Verfahren dieser Erfindung schließen Polystyrolkügelchen von etwa 1 Mikron bis etwa 5 Millimeter Durchmesser, erhältlich von Abbott Laboratories, North Chicago, IL; Polystyrolröhren, -stäbe oder -schaufeln einer beliebigen passenden Größe; und Polystyrolatex, dessen Polystyrolteilchen eine Größe von etwa 1 Mikron aufweisen und die durch Zentrifügieren von dem Latex getrennt werden konnen, ein.

Die feste Matrix kann auch aus einer Vielzahl von Materialien, wie vernetztem Dextran, z.B. Sephadex G-25, -50, -100, -200, und dergleichen, erhältlich von Pharmacia Fine Chemicals aus Piscataway, NJ, Agarose und vernetzter Agarose, z.B. Sepharose-6B, -CL-6B, -4B, -CL46 und dergleichen, ebenfalls erhältlich von Pharmacia Fine Chemicals, hergestellt sein.

-Ein Kit der Erfindung kann weiterhin einen Standard einschließen, gegen welchen die Ergebnisse des Assays zu vergleichen sind, und verschiedene Puffer in trockener oder flüssiger Form unter anderem für das Waschen der Wände der Mikrotiterplatte, das Verdünnen der Probe, das Verdünnen des markierten Reagenzes oder dergleichen.

Zum Zweck eines Verfahrens der Erfindung sind Festphasen-Assays, worin die zu untersuchende Probe an eine Fest-Phasen-Matrix angeheftet wird, wie eine Test-Vertiefüng einer Mikrotiterplatte oder ein Nitrozelluloseblatt, um einen festen Träger zu bilden, besonders bevorzugt. In solchen Fällen bildet die Vermischung der zu testenden Probe und des monoklonalen Rezeptors eine Versetzung einer festen mit einer flüssigen Phase. Die feste und die flüssige Phase werden nach einem angemessenen Inkubationszeitraum getrennt, und das Vorhandensein eines Flüssig-Rezeptor-Komplexes wird durch das Vorhandensein von an den festen Träger gebundenem Rezeptor bestimmt. Die relative Menge des gebundenen Rezeptors kann in vielen Assays bestimmt werden, wodurch auch eine Bestimmung der Menge des Onkoproteinliganden, die in der untersuchten Probe vorhanden war, bereitgestellt wird.

Ein Rezeptormolekül kann auch an die feste Matrix angeheftet sein, um einen festen Träger zu bilden. In diesem Fall wird die zu testende Probe hinzugemischt, um eine Vermischung einer festen mit einer flüssigen Phase zu bilden, die Mischung wird wie zuvor beschrieben aufrechterhalten und das Vorhandensein eines Immunkomplexes und eines Onkoproteins in der untersuchten Probe wird durch die Beimischung einer vorherbestimmten Menge eines markierten Liganden, wie einem Polypeptid oder einem Onkoprotein, welches von dem angehefteten Rezeptormolekül gebunden wird, bestimmt. Daher stellt das Vorhandensein eines zwischen dem Rezeptor und dem Onkoprotein der Probe gebildeten Komplexes ein Ausmaß der Bindung des markierten Liganden bereit, das geringer ist, als ein bekannter Kontrollbetrag, der aufgezeigt wird, wenn die Probe frei von dem getesteten Onkoprotein ist. Die relative Menge von Onkoprotein in der Probe kann bestimmt werden durch die Verwendung eines Überschusses des Rezeptors und das Messen der verringerten Bindung des markierten Liganden.

Für ein Verfahren der Erfindung kann ein Polypeptid oder ein Onkoproteinligand, gebunden von einem Rezeptormolekül, ebenfalls an eine feste Matrix angeheftet sein, um das Antigen auf dem festen Träger zu bilden. Eine bekannte Menge von Rezeptormolekülen im Überschuß wird mit der zu testenden Probe versetzt, um eine flüssige Mischung zu bilden. Die so gebildete flüssige Mischung wird während eines Zeitraums, der hinreichend ist, um ein Immunkomplex- Reaktionsprodukt zu bilden, aufrechterhalten und wird danach mit dem festen Träger vermischt, um eine Mischung einer festen und einer flüssigen Phase zu bilden. Diese Mischung wird während eines Zeitraums aufrechterhalten, der hinreichend ist, damit die vorhandenen, überschüssigen Rezeptormoleküle, die nicht reagiert haben, eine Immunreaktion eingehen und einen Komplex mit dem Antigen auf dem Fest-Phasen-Träger eingehen. Die Menge dieses Komplexes, der gebildet wird, wird nach der Trennung der festen und flüssigen Phasen unter Verwendung eines zuvor beschriebenen Verfahrens bestimmt. Dieses Verfahren kann eine Bestimmung bereitstellen, was das Vorhandensein eines Onkoproteins in der Probe betrifft, und ebenfalls, was seine relative Menge betrifft, wo festgesetzte Mengen von Rezeptor und Fest-Phasen-Ligand verwendet werden.

IV. Differentieller Assay

Die vorliegende Erfindung erfordert das Screenen flüssiger Körperproben mit monoklonalen Rezeptoren gegen mehr als ein Onkogen-codiertes Protein. Das Screenen von Proben mit mehr als einem monoklonalen Rezeptor stellt ein Muster von Onkoproteinen, die in der untersuchten Probe vorhanden sind, bereit.

In Patienten mit Brustkrebs findet man, daß p55ras und P40fes (Figuren 16 und 17) im Gegensatz zu dem p56sis gefünden in Patienten mit Blasen- und Prostatakrebs (Figur 1 g) erhöht sind. Blasen- und Prostatakrebspatienten zeigten auch oft erhöhte Spiegel der sis-verwandten Proteine von 31 kD oder 25 kD. Im Gegensatz dazu zeigte ein Spender mit einem gutartigen Prostataknötchen diese erhöhten Proteinspiegel nicht.

Hohe Spiegel der kleineren Proteine wurden ebenfalls in Patienten mit Lungen- und Cervixkrebs sowie mit Non-Hodgkin-Lymphomen (siehe Figur 23) gefünden In diesen Patienten fand man die sis-verwandten Proteine von 31 kl) und/oder 25 kD in Abwesenheit des 56 kD großen Proteins (siehe Figur 15, Spur 4, Bilddarstellungsfelder A-B).

So wurden in den Urinproben von Krebspatienten drei ungewöhnliche Muster beobachtet. Eine Untergruppe der Brustkrebspatienten hat erhöhte Spiegel von p55ras in Verbindung mit p40fes und/oder p35fes Im Gegensatz dazu scheiden Patienten mit Blasen- und Prostatakrebs erhöhte Mengen von allen drei sis-verwandten Proteinen in Abwesenheit von p55ras, p40fes und p35fes aus. Schließlich scheidet eine Untergruppe Lungenkrebs- und Lymphom-Patienten erhöhte Spiegel an lediglich den sis-verwandten Proteinen mit niedrigeren Molekulargewichtsgrößen aus. Wie aus den Figuren ersichtlich ist, korrelieren die Expressionsmuster mit den Erkrankungszuständen besser als die Ausscheidung hoher Spiegel eines einzelnen Onkogenverwandten Proteins. In offensichtlich normalen Individuen werden erhöhte Spiegel dieser Proteine selten nachgewiesen.

In Ubereinstimmung mit einem bevorzugten Verfahren der vorliegenden Erfindung wird eine Urinprobe oder ein Urinkonzentrat in einer wäßrigen Zusammensetzung, wie vorstehend beschrieben, mit einem Rezeptor vermischt, der mit einem Onkoprotein eine Immunreaktion eingeht. Die Mischung wird während eines Zeitraums, der hinreichend ist, damit sich ein Immunkomplex bildet, aufrechterhalten, und das Vorhandensein eines Immunkomplexes wird, wie vorstehend beschrieben, in Bezug auf das allgemeine Assay-Verfahren und die vorstehend beschriebenen spezifischen Verfahren, bestimmt.

Blotting-Verfahren, wie die des Western-Blots der Figuren und des sogenannten "Slot-Blots", worin die Probe an eine Nitrozellulosematrix als einem festen Träger angeheftet ist, und worin die Rezeptormoleküle in einer flüssigen waßrigen Zusammensetzung auf das Nitrozelluloseblatt versetzt werden, sind bevorzugte Techniken für die Analyse. Es sind jedoch auch andere Techniken nützlich, wie der Fest-Phasen-ELISA und der Radioimmunassay (RIA), welche Vertiefüngen von Mikrotiterplatten als die festen Matrizes verwenden, und Eintauchstab- Techniken sind ebenfalls nützlich.

V. Affinitätssorptionsmittel

Wie hierin vorstehend gezeigt, sind in einer Ausführung der Erfindung monoklonale Rezeptormoleküle mit einem festen Träger verknüpft, der chemisch inert gegenüber den nachzuweisenden Onkoproteinliganden, ist. Der Ausdruck "chemisch inert" wird hierin in der Bedeutung verwendet, daß zwischen dem festen Träger und den Onkoproteinliganden keine chemische Reaktion auftritt. Es können jedoch physikalische Wechselwirkungen zwischen dem festen Träger und den Onkoproteinliganden, wie eine unspezifische Bindung, auftreten und tun dies, obwohl solche Wechselwirkungen bevorzugtermaßen minimiert sind.

Der feste Träger kann aus einer Vielfalt von Materialien hergestellt sein, wie quervernetztem Dextran, z.B. Sephadex G-25, -50, -100, -200 und dergleichen, erh:;Itlich von Pharmacia Fine Chemicals aus Piscataway, New Jersey, Agarose und quervernetzter Agarose, z.B. Sepharose 6B, CL6B, 4B, CL4B und dergleichen, ebenfälls erhältlich von Pharmacia Fine Chemicals, oder Bio-Gel A-0.5M, A-1.5M, A-50M und dergleichen, erhältlich von Bio-Rad Laboratories, Richmond, Kalifornien, oder Polyacrylamidkügelchen, z.B. Bio-Gel P-2, P-30, P-100, P-300 und dergleichen, ebenfalls erhältlich von Bio-Rad Laboratories. Polyacrylamidkügelchen haben die geringste Neigung zu einer unspezifischen Bindung unter den obenstehenden Trägern, besitzen aber auch typischerweise eine niedrige Porösität, welche ihre Bindungskapazität beschränkt. Die Materialien aus Agarose und quervernetzter Agarose werden hierin bevorzugt und werden zur Veranschaulichung als ein fester Träger verwendet.

Der Agaroseträger wird typischerweise durch Cyanogenbromid für eine Bindung aktiviert. Der aktivierte Träger wird dann gewaschen und mit den Rezeptormolekülen ohne ein Trocknen des aktivierten Trägers verknüpft. Der mit dem Träger verknüpfte Rezeptor wird dann gewaschen und ist zur Verwendung bereit. Reaktive Gruppen auf dem Träger, die nicht reagiert haben, können mit einem Amin, wie Ethanolamin oder Tris, zur Reaktion gebracht werden, falls erwünscht, obwohl sich diese reaktiven Gruppen schnell zersetzen.

-Das Afflnitätssorptionsmittel kann in seinem losen Zustand, wie in einem Becherglas oder einem Kolben, verwendet werden oder es kann in einer Säule eingeschlossen sein. Vor der Verwendung ist es zu bevorzugen, daß das Alfinitätssorptionsmittel in dem Puffer oder einem anderen wäßrigen Medium, welches zur Reinigung des Onkoproteins verwendet wird, gewaschen wird, um unspezifisch gebundene Proteine oder diejenigen Rezeptoren zu eliminieren, die instabil mit dem Träger verknüpft wurden.

Eine wäßrige, einen Onkoproteinliganden enthaltende Zusammensetzung mit einer Aminosäurerest-Sequenz, die der Aminosäurerest-Sequenz des Polypeptids entspricht, an welches der verknüpfte Rezeptor des Aflinitätssorptionsmittels bindet, wie Serum oder ein Zellextrakt, wird bereitgestellt und dann mit dem Arfinitätssorptionsmittel versetzt. Diese Mischung bildet einen reversiblen, verknüpften Rezeptor-Liganden-Komplex zwischen dem verknüpften Rezeptor und dem Onkoproteinliganden.

Der Liganden-Rezeptor-Liganden-Komplex wird dann von dem Rest der nicht komplexierten wäßrigen Zusammensetzung getrennt, um dadurch das Onkoprotein in gereinigter Form, verknüpft mit dem Atfinitätssorptionsmittel, zu erhalten. Wenn das Vermischen in einem Becherglas oder einem Kolben stattfindet, kann diese Trennung durch eine Futration und Waschen vorgenommen werden. Wenn das Sorptionsmittel in einer Säule ist, kann die Trennung durch eine Elution des nicht komplexierten wäßrigen Mediums, wiederum bevorzugtermaßen gefolgt von einem Waschschritt, stattfinden.

Wenn das gereinigte Protein frei von dem Aifinitätssorptionsmittel gewünscht wird, kann es typischerweise durch eine Vielzahl von Verfahren erhalten werden. In einem beliebigen dieser Verfahren wird der reversibel verknüpfte Rezeptor-Liganden-Komplex in seine Teilkomponenten, den mit dem Träger verknüpften Rezeptor und den Onkoproteinliganden, dissoziiert, gefolgt von der Trennung dieses Liganden von dem verknüpften Rezeptor, um das gereinigte Onkoprotein frei von dem Atfinitätssorptionsmittel bereitzustellen.

Die Dissoziierung des reversiblen Komplexes kann auf eine Anzahl von Weisen durchgeführt werden. Eine 0,2molare Glycinhydrochloridlösung mit einem pH-Wert von etwa 2,5 wird typischerweise verwendet. Alternativerweise kann der gebundene Ligand von dem verknüpften Rezeptor durch eine Versetzung des reversiblen Komplexes mit einem Überschuß des zum Heranziehen des Rezeptors verwendeten immunogenen Polypeptids wegkompetitiert werden. Eine solche Kompetition verhindert eine mögliche Denaturierung des Liganden. Trennung der Mischung mit dem Affinitätssorptionsmittel. Diese Mischung bildet einen reversiblen verknüpften Rezeptor-Liganden-Komplex zwischen dem verknüpften Rezeptor und dem Onkoproteinliganden.

Der Liganden-Rezeptor-Liganden-Komplex wird dann von dem Rest der nicht komplexierten wäßrigen Zusammensetzung getrennt, um dadurch das Onkoprotein in gereinigter Form, verknüpft mit dem Affinitätssorptionsmittel zu erhalten. Wenn das Versetzen in einem Becherglas oder einem Kolben stattfindet, kann diese Trennung durch eine Filtration und Waschen hergestellt werden. Wenn das Sorptionsmittel in einer Säule ist, kann die Trennung durch eine Elution des nicht komplexierten wäßrigen Mediums, wiederum bevorzugtermaßen gefolgt von einem Waschschritt, stattfinden.

Wenn man wünscht, daß das gereinigte Protein frei von dem Alfinitätssorptionsmittel ist, kann es typischerweise durch eine Vielzahl von Verfahren erhalten werden. In einem beliebigen dieser Verfahren wird der reversibel verknüpfte Rezeptor-Liganden-Komplex in seine Teilkomponenten, den mit dem Träger verknüpften Rezeptor und den Onkoproteinliganden, dissoziiert, gefolgt von der Trennung dieses Liganden von dem verknüpften Rezeptor, um das gereinigte Onkoprotein frei von dem Affinitätssorptionsmittel bereitzustellen.

Die Dissoziierung des reversiblen Komplexes kann auf eine Anzahl von Weisen ausgeführt werden. Eine 0,2molare Glycinhydrochloridlösung mit einem pH-Wert von etwa 2,5 wird typischerweise verwendet. Alternativerweise kann der gebundene Ligand von dem verknüpften Rezeptor durch eine Versetzung des reversiblen Komplexes mit einem Überschuß des zum Heranziehen des Rezeptors verwendeten immunogenen Polypeptids wegkompetitiert werden. Eine solche Kompetition verhindert eine mögliche Denaturierung des Liganden.

Die Trennung des dissozijerten Onkoproteinliganden von dem Arfinitätssorptionsmittel kann wie oben beschrieben erhalten werden.

Eine detaillierte Beschreibung der Affinitätssorptionsmittel, der Verfahren ihrer Herstellung und Verwendung, wobei das Antigen mit dem Träger verknüpft ist, kann in Antibody as a Tool, Hrsg.: Marchalonis und Warr, John Wiley & Sons, New York, S.64-67 und 76-96 (1982) gefünden werden.

VI. Panel-Assay

Die Grundlage des Verfahrens der vorliegenden Erfindung ist die Anwendung eines Panel- Assays unter Anwendung von wenigstens zwei unterschiedlichen monoklonalen Rezeptormolekülen auf Körperproben. Eine Auswahl bzw. Panele von Antikörpern können verwendet werden, um im Grunde genommen eine beliebige biologische Probe zu charakterisieren, durch Vergleichen der in einer unbekannten Probe gebildeten Kombination von Komplexen von Antikörper/Antigen mit Kombinationen, die von einer bekannten Körperprobe erhalten werden. Gewebe, Urin oder andere Körperfiüssigkeiten können in Hinsicht auf die Expression von Onkogen- und Onkogen-verwandten Sequenzen charakterisiert werden. Diese Expression wird daher interpretiert, um den Zustand der Entwicklung von Geweben oder Embryonen oder die Anwesenheit von Krebs oder dessen Schwere anzuzeigen.

Ein Panel-Assay schließt das Screenen einer Probe mit mehr als einem Antikörper ein. Die Probe läßt man mit einem jeden Antikörper reagieren, und die Komplexe zwischen den Antikörpern und den in der Probe gefündenen Liganden werden nachgewiesen. Das Muster der Komplexe, das heißt die Kombination von Antikörpern, welche mit Liganden in der unbekannten Probe reagieren, wird mit einem Muster reagierender Antikörper in einer bekannten Probe verglichen. Je ähnlicher die Kombinationen sind, d.h. je höher die Koinzidenz desselben Antikörpers ist, mit denselben Liganden sowohl in der bekannten als auch in der unbekannten Probe zu reagieren, desto ähnlicher sind die Proben, d.h. desto höher ist die Wahrscheinlichkeit, daß die unbekannte Probe im selben Zustand der Entwicklung ist oder denselben Erkrankungszustand aufweist, wie die bekannte Probe.

Der Assay kann in einer Flüssigkeit durchgeführt werden oder unter Verwendung eines festen Substrates, wie vorstehend angegeben. Als Beispiel wurden Aliquots von Körperproben elektrophoretisch in ein Gel eingebracht und auf Nitrozellulose transferiert, welche dann in Streifen geschnitten wurde. Dieses Western-Blot-Vorgehen gestattet, daß dieselbe Probe mit einer Auswahl bzw. einem Panel von Antikörpern sondiert wird. Durch das Wiederherstellen des ursprünglichen Nitrozelluloseblocks kann die Identität spezifischer und unspezifischer Banden leicht bestimmt werden. Von Zell- oder Gewebeextrakten wurden etwa 0,5 mg Protein pro Gel geladen. Von Urinproben wurde das Äquivalent von 12 ml Urin zugefügt und von anderen Körperflüssigkeiten (Serum, Plasma, Amnionflüssigkeit, Follikularflüssigkeit, Aszitesflüssigkeit, Speichel) wurden 100 µl geladen. Zusätzlich zum Sondieren einer jeden Probe mit mehreren Antikörpern wurden bis zu 24 Proben mit demselben Antikörper sondiert. Dieses Vorgehen erzeugt differentielle Bindungsaktivitäten aufgrund unterschiedlicher Antigenkonzentrationen und keine Variabilität ufgrund von Nebenreagenzien oder Inkubationsbedingungen. Die Bindung kann auch durch das Sondieren von Proben, die in Reihe verdünnt worden sind, um relative Erhöhungen der Konzentration über nachweisbare Spiegel zu erhalten, semiquantifiziert werden.

Die Verwendung des festen Trägers stellt ein Mittel für die Analyse von Proben unter Verwendung von automatisierten Scannern bereit. Diese Scanner können programmiert werden, um die Information auf der Nitrozellulose zu digitalisieren, und weiter programmiert werden, um Proben zu vergleichen. Auf diese Weise können Panel-Assays unter Verwendung einer Vielzahl von Antikörpern automatisch durchgeführt werden. Dies kann zum Beispiel zur Charakterisierung großer Zahlen von bekannten Proben verwendet werden, um gemeinsame Merkinale zu bestimmen sowie für die Charakterisierung großer Zahlen unbekannter Proben gegen eine bekannte. Dieses Verfahren hat auch ein genaueres Bewerten der Reaktivitätsmuster zur Folge, da ein solches Bewerten durch Verwendung der digitalisierten Information durchgeführt wird.

Die Probe kann ebenfalls gleichzeitig mit einer Vielfalt von Antikörpern sondiert werden, wie durch Anwendung eines Cocktails von Antikörpern. Diese Vorgehensweise kann ein effizienteres Mittel für eine Erzeugung von Reaktivitätsmustern bereitstellen, aber sie kann komplexe Muster erzeugen, welche schwer zu analysieren sein können.

Die nachstehend erörterten Ergebnisse wurden unter Verwendung von getrennten Nitrozellulosestreifen erhalten, wobei ein jeder eine Spur enthielt, in welche ein Aliquot der Probe gelaufen war und welche getrennt unter Verwendung eines Immunblot-Assays, wie oben beschrieben, sondiert wurde.

Anfänglich wurden Proben bekannten Ursprungs sondiert, um Profile zu erhalten, mit welchen unbekannte Proben verglichen werden konnten. Verschiedene Vorgehensweisen wurden angewandt, um solche Profile abzuleiten. Was eine Vorgehensweise betrifft, so wurden mehrere Antikörper, welche dasselbe Protein erkennen, identifiziert. Dieses Vorgehen erhöht die Genauigkeit der Sonden-Identifizierung. Eine zweite Vorgehensweise bestand darin, ein Profil unterschiedlicher Tumorextrakte mit derselben Auswahl. von Antikörpern zu erstellen. Dies erzeugte eine Vielzahl von Mustern, mit denen unbekannte Proben verglichen werden konnten. Eine dritte Vorgehensweise bestand darin, die Profile normaler Gewebe zu erstellen, um Entwicklungsproflle für verschiedene Organe zu entwickeln. Alle diese Vorgehensweisen wurden vorgenommen, um Reaktivitätsmuster für bekannte Proben zu erzeugen, mit denen die Muster von unbekannten Proben verglichen werden können.

Ein Beispiel für die Verwendung von Hybridomen mit unterschiedlichen Spezifitäten wird durch Antikörper gegen fes bereitgestellt, die eine Vielzahl von Reaktivitätsmustern gegen die ATP-bindende Domäne von Kinasegenen erzeugen. Die ähnlichen Muster der Kreuzreaktivität gestatten es, die Antikörper zu gruppieren und an verschiedenen biologischen Proben zu testen. In der Figur 25 wurde eine das Onkogenprodukt fes enthaltende Zellinie mit einer Gruppe von Antikörpern, die gegen zwei Bereiche der Sequenz von fes sowie gegen ein anderes Onkogen, erbB, gerichtet waren, sondiert. In der Spur 1 wurde das Produkt des fes Gens ohne weiteres durch einen Antikörper, welcher gegen eine in einem anderen konservierten Kinasebereich lokalisierte Sequenz von fes gerichtet war, nachgewiesen. Eine Überexposition des Geis zeigte für das Produkt des fes-Gens eine Bindung durch die in den Spuren A-H verwendeten Antikörper, doch die Bindungsaktivitat ist merklich geringer als die des in Spur 1 verwendeten Antikörpers. Als eine weitere Kontrolle erkannten die zwei Antikörper in den Spuren J bzw. K ein mit erbB verwandtes Protein.

In der Figur 26 wurden dieselben Antikörper gleichzeitig verwendet, um einen Extrakt aus einer Zellinie, welche den EGF-Rezeptor enthält (welcher von dem Protoonkogen erbB codiert wird), zu sondieren. Dieses Protein wird ohne weiteres von den Antikörpern gegen erbB, zusätzlich zu p130erbB, welches ebenfalls in der mit fes transformierten Zellinie gesehen wurde (Figur 25), detektiert. Die in den Spuren D, F, G verwendeten Antikörper gegen fes detektieren ein zusätzliches Protein, p30fes, welches nicht in der Spur E nachgewiesen wurde. Ein ELISA-Test zeigte jedoch, daß das Muster der Kreuzreaktivität für diesen Antikörper dem in Spur D verwendeten Antikörper ähnlich ist und identisch ist zu den Antikörpern, die in den Spuren F und G verwendet wurden.

Diese selben Antikörper wurden in der Figur 27 verwendet, um eine konzentrierte Urinprobe von einer schwangeren Patientin mit Diabetes zu sondieren. Ein Protein von etwa 70 kDa wurde durch die drei Antikörper, die in den Spuren A-C verwendet wurden, nachgewiesen, während ein Protein von 55 kDa in den Spuren D-H nachgewiesen wurde. Daher sind die Muster der Kreuzreaktivität dieser fes-Proteine nützlich für die Identifizierung von Antikörpern, welche wahrscheinlich dasselbe Protein erkennen. Die feinen Unterschiede bei den Reaktivitätsmustern können verwendet werden, um das Vorhandensein mehrerer Onkogenverwandter Determinanten auf einem einzelnen Protein zu zeigen. Dies wird durch die 5 Antikörper gezeigt, welche das 55 kDa große Protein detektieren und wenigstens drei unterschiedliche fes-verwandte Epitope erkennen. Die Fähigkeit der Antikörper, p70fes, p55fes und P30fes nachzuweisen, kann auch Unterschiede der post-translationalen Modifikation der Konformation der ATP-bindenden Domäne des Produkts desfes-Onkogens widerspiegeln.

Das Erstellen desj)rofils von Tumorextrakten, wie von denjenigen, die aus in dem NIH-Depot hinterlegten Zellinien stammen, stellt ebenfalls Ziele für eine Erkennung durch Antikörper bereit. In den Figuren 28-31 wurden verschiedene Tumorextrakte mit Antikörpern gegen fes oder erbB sondiert. Die Spuren A-D wurden mit Antikörpern, die gegen einen Teil der ATPbindenden Stelle eines Kinasegens gerichtet waren, sondiert. Die Spuren E-H wurden mit Antikörpern, die gegen unterschiedliche Teile derselben Bindungsstelle gerichtet waren, sondiere. Die Spuren I und J werden mit Antikörpern, die gegen das Aminoende von v-erbB gerichtet sind (173-1C11 und 173-4A11) sondiert, während die Spuren Kund L mit gegen eine andere Kinasedomäne gerichteten Antikörpern sondiert wurden. Diese Sondierungen erforderten eine minimale Menge an Material (0,5 g Gewebe wurde mit 64 Antikörpern sondiert) und erzeugten ein breites Spektrum an Reaktivitätsmustern.

In der Figur 28 wurde gezeigt, daß der Extrakt eines Endometrialkrebses niedrige Spiegel an p60fes (Spuren A-D) und p70 (Spuren E-H) hat, während p200erbB (Spuren 1, J) ohne weiteres nachgewiesen wird. Das p200erbB wurde zuvor bei höchsten Spiegeln in embryonalem Herz nachgewiesen (Daten nicht gezeigt). Diese Expression von p&sub2;&sub0;&sub0;erbB scheint in Hinsicht auf die Zeit und das Gewebe unangemessen zu sein.

In der Figur 29 wurde der Extrakt eines metastasierenden Brusttumors mit denselben Antikörpern sondiert. In diesem Tumor wird p70fes ohne weiteres in Abwesenheit von p60fes nachgewiesen. Die gegen das Aminoende von erbB gerichteten Antikörper detektieren p30erbB und p35erbB und p40erbB, während die gegen den Carboxyanteil des viralen Proteins gerichteten Antikörper p130erbB detektieren.

In der Figur 30 erzeugte ein anderer Brustkrebsextrakt ein anderes Reaktivitätsmuster. Zusätzlich zu p70fes wurde eine schwache Aktivität für p80fes nachgewiesen. Beide von diesen Proteinen wurden mit allen vier Antikörpern nachgewiesen, obwohl diese Gruppe wenigstens drei unterschiedliche Epitope erkannte. Eine Doppelbande von erbB, p130erbB, wurde ebenfalls schwach nachgewiesen (Spuren K, L).

In der Figur 31 erzeugte ein Ovarkarzinom ein anderes Reaktivitätsmuster. p60fes wurde schwach nachgewiesen (Spuren A-D), genauso wie p35fes (Spuren E-H), während p70fes ohne weiteres nachgewiesen wurde (Spuren A-D), genauso wie p35fesB (Spuren 1, J). Daher zeigte jeder Tumor ein eigenes Reaktivitätsmuster und jedes beschriebene Protein wurde von wenigstens 2 Antikörpern nachgewiesen. Die Proteine in den Spuren E-H enthielten wenigstens drei fes-verwandte Epitope, obwohl die Proteine möglicherweise nicht von dem Onkogen fes codiert wurden.

In den Figuren 32-39 wurden mehrere zusätzliche Onkogen-verwandte Proteine mit einer anderen Auswahl von Antikörpern nachgewiesen. In der Spur A von jeder Figur wurde ein Antikörper gegen die ros-Sequenz eines konservierten Kinasegens verwendet, wänrend ein Antikörper gegen eine davon verschiedene Kinasedomäne III in der Spur B verwendet wurde. In den Spuren C-G wurden 5 Antikörper gegen das Aminoende von β-TGF als Sonden verwendet. Drei Antikörper gegen den einzigartigen Carboxylanteil der Sequenz von H-ras wurden in den Spuren H-J verwendet, während vier Antikörper gegen einen konservierten Bereich in der Hormon-bindenden Domäne von erba in den Spuren K-N verwendet wurden.

In der Figur 32 wurde ein Extrakt eines Brustkarzinoms mit dieser Reihe von Antikörpern sondiert. In den Spuren A und B wurde ein Protein von 150 kDa mit ros- und fes-Antikörpern, die gegen zwei unterschiedliche konservierte Bereiche der Kinasedomäne gerichtet waren, nachgewiesen, was eine extensive Homologie der Kinase nahelegt. Die ros-Antikörper wiesen auch ein Protein von 120 und von 40 kl)a nach. In den Spuren C-G wurde ein Protein von 25 kDa durch alle β-TGF-Antikörper nachgewiesen. Diese Antikörper erkennen wenigstens 3 unterschiedliche Epitope, basierend auf Immunblots (man beachte die zusätzliche Bande bei 45 kDa in Spur C). In den Spuren H-J wurden fünf unterschiedliche ras-verwandte Proteine nachgewiesen. Die Verhältnisse der Bindungsaktivitäten für diese ras-verwandten Proteine legen nahe, daß jeder von diesen Antikörpern eine einzige Determinante nachweist. Der Antikörper (146-3E4) in der Spur H weist vorzugsweise p200ras, p48ras und p27ras nach. Im Gegensatz dazu weist der in der Spur J verwendete Antikörper (146-17A5) vorzugsweise p21ras nach. In dieser Exposition wurden diese Unterschiede am leichtesten durch den Vergleich der Intensitäten von p27ras mit p21ras gesehen. Obwohl p27 nur schwach in der Spur J nachgewiesen wurde und p21 nur schwach in der Spur H nachgewiesen wurde, zeigt eine Überexposition des Gels, daß alle 5 ras-verwandten Proteine durch alle drei Antikörper nachgewiesen wurden.

Das in der Figur 33 sondierte Ovarkarzinom ist ähnlich zu der Figur 8, außer daß plsoras/fes nicht nachgewiesen wurde, sondern ein β-TGF-Protein von 50 kDa in der Spur G erscheint. Das in der Figur 34 sondierte metastasierende Colonkarzinom ist ebenfalls ähnlich, außer daß die β-TGF-Proteine von 45 und 50 kDa nicht nachgewiesen werden. Der Ovarextrakt in der Figur 35 ist ebenfalls ähnlich, außer daß p45ras und p52fes in höheren Konzentrationen relativ zu den anderen ros-verwandten Proteinen vorhanden waren und die ros-verwandten Proteine nicht gesehen wurden.

Der in der Figur 36 sondierte Lymphomextrakt ist einzigartig aufgrund seiner relativ hohen Konzentration an p27. Der in der Figur 37 sondierte Extrakt des Brustkarzinoms erzeugte ein anderes einzigartiges Reaktionsmuster. Obwohl wenig Aktivität für die ros-, fes- oder rasverwandten Proteine nachgewiesen wurde, wurde p24-β-TGF ohne weiteres nachgewiesen, genauso wie p22erbA und p55erbA. p22erbA wurde durch alle vier Antikörper erkannt, während p55erbA ohne weiteres nur durch den in der Spur N verwendeten Antikörper nachgewiesen wurde. Eine Überexposition zeigte mit diesem Protein eine Bindung durch die anderen drei Antikörper gegen erbA. Die differentielle Aktivität mit p55erbA und p22erbA zeigt an, daß beide von diesen Proteinen zwei mit erbA verwandte Epitope haben. Darüber hinaus gingen die Antikörper mit dem homologen Bereich des Glucocortikoid- oder des Östrogenrezeptors keine Kreuzreaktion ein, und die Antikörper erzeugen nukleäre Färbungsmuster (Daten nicht gezeigt). Daher hat der Brusttumor im Gegensatz zu den in den Figuren 32-37 sondierten Extrakten erhöhte Spiegel von p22erbA . Das Protein p22erbA wurde eber£alls in dem Extrakt des rektalen Tumors der Figur 38 gesehen, obwohl p55erbA nicht einmal in dem überexponierten Gel nachgewiesen wurde. In der Figur 39 wies der Lungenmetastasenextrakt p52fes und ein einzigartiges Aktivitätsmuster mit den ras-Sonden auf Obwohl P48ras und p200ras ohne weiteres nachgewiesen wurden, wurde sehr wenig Aktivität bezüglich p27ras oder p21ras gesehen. Dieses Ergebnis war dem Profil verschiedener embryonaler Gewebe ähnlich (siehe unten). Wenn diese Gewebe sich entwickeln, nahm die Konzentration von p200ras ab, während die Konzentration von p27ras zunahm.

Obwohl bei den Tumorproben eine beträchtliche Diversität gesehen wird, wurden in normalen Geweben bemerkenswerte Ahnlichkeiten gefünden Diese Ahnlichkeiten gestatten es, Entwicklungsproflle für unterschiedliche Organe zu erzeugen. In der Figur 40 wurde ein Entwicklungsprofll des Striatum der Ratte mit 7 Antikörpern erzeugt. In der Spur A wurden p21ras und p25ras in dem 18 Tage alten Embryo nachgewiesen. Am Tag 2 wurde p150ras zusätzlich zu p21ras knapp nachgewiesen, und p25ras wurde ohne weiteres nachgewiesen und ist in den nachfolgenden Bilddarstellungsfeldern vorhanden. In der Spur B wurde p52ras ohne weiteres bei 18 Tagen fötaler Entwicklung gesehen. Eine Uberexposition des Geis enthüllte P200ras. Mit 18 Tagen wurde p27ras leicht gesehen (p200ras war im überexponierten Gel nicht länger detektierbar). Die Konzentration von p27ras war am Tag 70 am höchsten. p21ras war ebenfalls ohne weiteres am Tag 70 detektierbar, obwohl eine Überexposition anzeigte, daß p21ras zu allen fünf Zeitpunkten vorhanden war. In der Spur C war p150myc ebenfalls ein Erwachsenenspezifisches Protein, welches am Tag 2 kaum nachgewiesen wurde, aber ohne weiteres am Tag 18 ersichtlich war. In der Spur D war p120myb ein für den Embryo spezifisches Protein, welches nur in dem fötalen Feld nachgewiesen wurde. In der Spur E scheinen p100int-1 p70int-1, p45int-1 , p90sis und p56sis nicht entwicklungsbedingt reguliert zu sein. In der Spur G war p60sis am höchsten in dem Embryo-Bilddarstellungsfeld. Daher sind im Gegensatz zu den in den Figuren 4-15 beschriebenen Tumorextrakten die Profile der Onkogen-verwandten Proteine von normalen Geweben wesentlich einheitlicher und straffer reguliert.

Somit 7eigen die Figuren 25 bis 40, daß eine bekannte Probe mit verschiedenen Antikörpern sondiert werden kann, um ein Reaktivitätsmuster zu erzeugen. Die obenstehenden Beispiele zeigen die Kreuzreaktivität verschiedener Antikörper nicht nur unter denselben Proteinen in unterschiedlichen Proben, sondern ebenfalls zwischen verschiedenen Proteinen.

A. Klassifizierung bekannter Proben

Tumorextrakte oder andere Körperproben können ebenfalls den verschiedenen erzeugten Genprodukten gemäß charakterisiert werden. Vorliegend wurden verschiedene Tumorextrakt x Antikörper-Kombinationen unter Verwendung des Immunblot-Verfahrens bewertet, um das Vorhandensein und die Spiegel verschiedener Onkogenprodukte zu bestimmen. Diese Daten werden in den Figuren 41 und 42 präsentiert. Die Tumorextrakte stammten von in dem NIH- Depot hinterlegten Zellinien, und die Proben wurden einer Elektrophorese unterzogen und auf Nitrozellulose geblottet, wie oben beschrieben. Antikörper gegen von Onkogenen aus verschiedenen Onkogenfamilien codierte Polypeptide wurden verwendet, um die Proben zu sondieren.

Die Reaktivitäten wurden bezüglich des Vorhandenseins und des Spiegels der Expression des Onkogen-Produktes bewertet. In der Figur 41 wurde p52ras in allen Ovar-Extrakten nachgewiesen, aber die höchsten Spiegel wurden in Tumoren, die als minimal oder als mittel aufgelistet sind, gefünden. p60src und p48src wurden hauptsächlich in den Ovartumoren nachgewiesen mit den höchsten Häufigkeiten in der fortgeschrittenen Kategorie. p125ros und p150ros wurden in den meisten Tumoren, außer in den Brustextrakten, nachgewiesen, die Expression war in den Adenomen und denjenigen Karzinomen, die als minimal oder mittel klassifiziert wurden, konzentriert. Die Expression von p150ros war in den Brusttumoren in Gegensatz zu p120ros konzentriert, welches nur bei der Hälfte der Brusttumore gefünden wurde, obwohl dieses Protein in den meisten anderen Tumoren mit der Ausnahme der endometrialen Extrakte gefünden wurde. p22erbA war über diese Gewebe verstreut, wurde jedoch in keinem der als fortgeschritten aufgelisteten Extrakte gefünden

Eine zusätzliche Aufspaltung der Aktivitäten ist in der Figur 42, welche mehrere der Kinaseverwandten Proteine auflistet, ersichtlich. Die hohen Spiegel von p70fes in den Ovar- und Endometrialextrakten in dieser Tabelle sind bemerkenswert. In ähnlicher Weise kann die Begrenzung von p130erbB auf die Ovar- und Lungenextrakte signifikant sein.

Daher können die Tumorextrakte hinsichtlich den Onkogen- oder Onkogen-verwandten Produkten charakterisiert werden. Unter Verwendung spezifischer Antikörper können Proteine, die bei spezifischen Tumorarten häufig sind, nachgewiesen werden. Diese Reaktivitätsmuster können als ein Standard verwendet werden, mit welchem die Muster von unbekannten Proben 40 verglichen werden können.

B. Marker in Körperflüssigkeiten

Der Panel-Assay kann ebenfalls verwendet werden, um die Proteinherstellung in einem einzelnen Individuum zu überwachen. Auf diese Weise können die Wirkungen der Therapie auf eine nicht-invasive Weise durch das Screenen von, zum Beispiel, Urinproben überwacht werden. Diese Vorgehensweise schließt das Screenen einer Originalprobe von einem Patienten, um ein Profil des Aktivitätsmusters einer Auswahl bzw. eines Panels von Antikörpern zu erhalten, ein. Während die Therapie voranschreitet, werden aufeinanderfolgende Proben unter Verwendung derselben Originalprobe als Vergleichsstandard überwacht. Die Figur 43 zeigt aufeinanderfolgende Urinproben von einem Patienten mit einer Schwangerschafts-Trophoblastenerkrahkung, der einer Chemotherapie unterzogen wird. Das asynchrone Auftreten einer Anzahl von Onkogen-verwandten Proteinen ist offensichtlich. Diese Daten können weiter mit klinischen Daten korreliert werden, die die Effektivität der Therapie betreffen, um Patienten nach der Therapie zu überwachen.

C. Nachweis von Onkogen-verwandten Proteinen

Antikörper gegen von Onkogenen codierte Polypeptide können andere Proteine erkennen, welche ebenfalls das konservierte Polypeptid oder Anteile davon enthalten. Daher können Panele von Antikörpern verwendet werden, um onkogen-verwandte Proteine in einer Probe durch das Sondieren der Probe mit mehreren Antikörpern, jeweils gegen andere Bereiche des Polypeptids, nachzuweisen. Durch das Bestimmen eines Reaktivitätsmusters mit verschiedenen Antikörpern, können verschiedene Onkogen-verwandte Proteine identifiziert werden.

Das mit dem H-ras-spezifischen Antikörper nachgewiesene p21ras repräsentiert eine Untergruppe des p21ras, das mit dem in breiter Weise reaktiven Antikörper nachgewiesen wird. Alle Proben, die das mit den H-ras-spezifischen Antikörpern nachgewiesene p21 enthielten, enthielten das mit dem Antikörper 142-24E05 nachgewiesene p21, jedoch nicht umgekehrt. Die anderen durch die für H-ras spezifischen Antikörper nachgewiesenen Proteine wurden nicht mit 142-24E05 nachgewiesen, was anzeigte, daß der konservierte Bereich von ras nicht vorhanden oder wenigstens so verändert ist, daß er eine Bindung von 142-24E5 ausschließt. Die Übereinstimmung der Bindung durch die drei H-ras-speziflschen Antikörper zeigt jedoch, daß dasselbe Protein von allen drei Antikörpern nachgewiesen wurde. Das ännliche Verhältnis des Bindens der Antikörper gegen p200ras, p48ras und p27ras legt eine gewisse strukturelle Ahnlichkeit der von den drei Antikörpern nachgewiesenen Epitope nahe. Dieser Ahnlichkeit kann man sich unter Verwendung einer Anzahl von Verfahren zuwenden. Eine Vorgehensweise besteht darin, markierte Antigene zu verdauen und den Verdau einer zweidimensionalen Peptidkartierung zu unterziehen. Falls das größere Molekül in Losung mcht gut erkannt wird, sind zusätzliche Vorgehensweisen möglich. Zum Beispiel können Proben mit unterschiedlichen Kombinationen immunologisch verwandter Proteine einem partiellen Verdau unterzogen werden und immungeblottet werden. Falls es eine Voriäufer-Produkt-Beziehung gibt, sollte das mit dem Antikörper nachgewiesene Protein mit der geringsten Größe dasselbe sein (eine Kontrollinkubation ohne zugefügte Proteasen würde auf Proben-Unterschiede hinsichtlich endogener Proteasen kontrollieren). Alternativerweise kann der Partiellverdau (um die antigene Stelle zu exponieren) mittels Immunaffinität gereinigt werden und dann einem Immunoblot oder einer Peptidkartierung unterzogen werden. Die Identität von Proteinen mit einer ähnlichen Größe, die von unterschiedlichen Antikörpern oder demselben Antikörper in unterschiedlichen Proben nachgewiesen werden (d. h. Urin und Gewebe), können unter Verwendung ähnlicher Vorgehensweisen getestet werden, oder der isoelektrische Punkt kann unter Verwendung von zweidimensionalen Gelen und einem Nachweis durch einen Immunoblot bestimmt werden. Diese Vorgehensweise ist ebenfalls für eine Identifizierung mehrfacher Formen, die mit ähnlichen Geschwindigkeiten in SDS-Polyacrylamidgelen migrieren, nützlich.

VII. Materialien und Methoden A. Heranzüchten von Viren und Zellinien

Eine nicht-infizierte Nerzlungen-Zellinie (CCL64), dieselbe Linie, die in produktiver Weise mit dem Snyder-Theilen-Stamm des Katzen-Sarkom-Virus (ST-FeSV) und dem Katzen-Leukämle- Virus B (FeLV-B) transformiert wurde und als MSTF bezeichnet wird, sowie dieselbe Linie, die in nicht-produktiver Weise mit dem Gardner-Arnstein-Katzen-Sarkom-Virus (GA-FeSV) infiziert wurde und als 64F3C17 bezeichnet wird, wurden kultiviert, wie in Sen et al., Proc. Natl. Acad. Sci. USA 80:1 246-1 250 (1983) beschrieben. Eine nicht produzierende Vogel- Myeloblasten-Zellinie, die in nicht-produktiver Weise mit einem Vogel-Myeloblastose-Virus infiziert war, wurde kultiviert, wie in Duesberg et al., Froc. Natl Acad. Sci. USA 77: 5 120- 5 124 (1980) beschrieben.

Die nicht produzierende Krallenaffen-Zellinie, die in nicht-produktiver Weise mit dem Affen- Sarkom-Virus (55V) infiziert wurde und als NPV/SiSV und NPVI/SiSV bezeichnet wird, wurde kultiviert, wie in Devare et al., Proc. Natl Acad. Sci. USA 80: 731-735 (1983) beschrieben. Die nicht-produktiv transformierte, mit dem Fujinami-Sarkom-Virus (FSV) infizierte Vogel-Fibroblasten-Zellinie war ein Geschenk von B. Sefton aus dem Salk Institute, La Jolla, Kalifornien. Nicht-infizierte Mäuse-NIH-3T3-Fibroblastenzellen und Mäuse-NIH 3T3-Fibroblastenzellen, die in produktiver Weise mit dem Harvey-Mäuse-Sarkom-Virus infiziert waren, wurden kultiviert, wie in Todaro et al., J Celk Biol 17: 299-313 (1963) und Harvey, Nature 204: 1104- 1105 (1964) beschrieben. Die humanen Blasenkarzinomzellen T24 wurden kultiviert, wie in Bubenik et al., Jnt. J Cancer 11: 765-773 (1973) beschrieben.

B. Synthese der Peptide

Die Polypeptide wurden unter Verwendung von Fest-Phasen-Verfahren, wie in Marglin und Merrifield, A. Rev. Biochem. 39: 841-866 (1970) beschrieben, synthetisiert und durch Aminosäureanalysen bestätigt. Die Sequenzinformation wird entweder von der Aminosauresequenzierung des viralen Proteins oder von auf der Nucleotidsequenzierung basierenden Voraussagen abgeleitet. Die Quellen der Sequenzinformation waren die in den Fußnoten, die sich auf diese Sequenzen und ihre Onkogene beziehen, aufgelisteten.

Was die Polypeptide mit weniger als 35 Resten, die in den immunisierenden Inokula verwendet wurden, betrifft, so wurde ein Cysteinrest dem Aminoende oder dem Carboxylende eines jeden Polypeptids, dessen entsprechende Onkoprotein-Sequenz keinen solchen Rest enthielt, hinzugefügt. Die Cys-Reste wurden verwendet, um das, wie nachstehend beschriebene, Koppeln an einen Proteinträger zu unterstützen.

Bei der Herstellung eines nützlichen synthetischen Polypeptids durch das obengenannte Fest- Phasen-Verfahren, wurden die Aminosaurereste mit einem quervernetzten Harz (feste Phase) über eine Esterbindung von dem carboxyterminalen Rest aus verknüpft. Wenn das Polypeptid mit einem Träger über einen Cys-Rest verknüpft war, wurde dieser Cys-Rest in bequemer Weise als der carboxyterminale Rest verwendet, der an das Harz Ester-gebunden wurde.

Die alpha-Aminogruppe einer jeden zugefügten Aminosäure wurde typischerweise durch eine tertiär-Butoxycarbonylgruppe (t-BOC) geschützt, bevor die Aminosäure an die wachsende Polypeptidkette angefügt wurde. Die t-BOC-Gruppe wurde dann durch Standardverfahren vor der Hinzufügung der nächsten Aminosaure zu der wachsenden Polypeptidkette entfernt.

Reaktive Aminosäureseitenketten wurden ebenfalls während der Synthese der Polypeptide geschützt. Gewöhnliche, die Seitenketten schützende Gruppen wurden für die verbleibenden Aminosäurereste wie folgt verwendet: O-p-(Brombenzyloxycarbonyl) für Tyrosin, O-Benzyl für Threonin, Serin, Asparaginsäure und Glutaminsäure, 5-Methoxybenzyl für Cystein, Dinitrophenyl für Histidin, 2-Chlorbenzoxycarbonyl für Lysin, und Tosyl für Arginin.

Die geschützten Aminosäuren wurden aus geeigneten Lösungsmitteln umkristallisiert, um einzelne Flecken in einer Dünnschichtchromatographie zu ergeben. Die Kopplungen wurden typischerweise unter Verwendung eines zehnfachen molaren Uberschusses von sowohl geschützter Aminosäure als auch Dicyclohexylcarbodiimid über die Anzahl der Milhäquivalente der anfänglichen N-terminalen Aminosaure, durchgeführt. Ein zweimolarer Überschuß von beiden Reagenzien kann ebenfalls verwendet werden. Was Asparagin betrifft, so wurde eine gleiche molare Menge von N-Hydroxybenzotriazol zu der geschützten Aminosaure hinzugegeben und als das Lösungsmittel wurde Dimethylformamid verwendet. Nach dem Pikrinsäuretest von Gisin, Anal. Chem. Acta. 58: 248-249 (1972) waren alle Kopplungsreaktionen zu mehr als 99 % abgeschlossen.

Nach der Herstellung eines gewünschten Polypeptids wurde ein Teil des resultierenden geschützten Polypeptids (etwa 1 Gramm) mit zwei Millilitern Anisol behandelt, und wasserfreier Fluorwasserstoff, etwa 20 Milliliter, wurde in das Reaktionsgefäß bei der Temperatur von Trockeneis kondensiert. Die resultierende Mischung wurde bei etwa 4ºC etwa eine Stunde lang gerührt, um die Schutzgruppen zu spalten und das Polypeptid von dem Harz zu entfernen. Nach der Verdampfüng des Fluorwasserstoffs bei einer Temperatur von 4ºC mit einem Strom von N&sub2; wurde der Rückstand dreimal mit wasserfreiem Diethylether extrahiert, um das Anisol zu entfernen, und der Rückstand wurde im Vakuum getrocknet.

Das vakuumgetrocknete Material wurde mit 5 %iger wäßriger Essigsäure extrahiert (dreimal 50 Milliliter), um das freie Polypeptid von dem Harz zu trennen. Die Extrakt-haltige Lösung wurde lyophilisiert, um ein nicht-oxidiertes, synthetisches Polypeptid von dem Harz bereitzustellen. Die Extrakt-haltige Lösung wurde lyophilisiert, um ein nicht-oxidiertes, synthetisches Polypeptid bereitzustellen.

C. Koppeln der synthetischen Polypeptide an ein Trägerprotein

Die nicht-oxidierten synthetischen Polypeptide wurden an das Trägerprotein, das Hämocyanin der Schlüssellochnapfschnecke (KLH) über einen Cysteinrest (Cys, C) des Polypeptids mit m- Maleimidobenzoyl-N-hydroxysuccinimidester als Kopplungsreagenz, wie in Green, et al., Cell 28: 477 und 487 (1982) beschrieben, gekoppelt. Wo in einer Sequenz ein Cystein-Rest ein terminaler Rest war, wurde ein zusätzlicher Cysteinrest nicht hinzugefügt.

Kurz gesagt, als ein allgemeines Verfahren für ein jedes Polypeptid, wurden 4 Milligramm KLH in 0,25 Millilitern lomillimolaren Natriumphosphatpuffers (pH 7,2) mit 0,7 Milligramm von MBS, das in Dimethylformamid (DMF) gelöst war, zur Reaktion gebracht, und die resultierende Mischung wurde 30 Minuten lang bei Raumtemperatur gerührt. Die MBS- Lösung wurde tropfenweise zugegeben, um sicherzustellen, daß die lokale Konzentration von DMF nicht zu hoch war, da das KLH bei DMF-Konzentrationen von etwa 30 % oder höher unlöslich ist. Das Reaktionsprodukt, KLH-MB, wurde über eine mit Sephadex G-25 (Pharmacia Fine Chemicals, Piscataway, NJ) hergestellte Chromatographiesäule, äquilibriert mit Somillimolarem Natriumphosphatpuffer (pH 6,0), gegeben, um freies MBS zu entfernen. Die Wiedergewinnung von KLH aus den Peakfraktionen des Säuleneluats, überwacht bei 280 nm, wurde auf etwa 80 % geschätzt.

Das auf diese Weise hergestellte KLH-MB wurde dann mit 5 Milligramm, in 1 Milliliter Puffer gelöstem Polypeptid zur Reaktion gebracht. Der pH-Wert der resultierenden Reaktionszusammensetzung wurde auf 7-7,5 eingestellt, und die Reaktionszusammensetzung wurde bei Raumtemperatur 3 Stunden lang gerührt.

D. Immunisierung und Fusion 1. fes-verwandte Polypeptide

Polypeptide, wie diejenigen, die in der Aminosäurerest-Sequenz einem Teil des v-fes-Onkoproteins von ST-FeSV entsprechen, wurden an KLH gekoppelt und wurden verwendet, um 129- GIX&spplus;-Mäuse, wie vorstehend und in Niman et al., in Monodonal Antibodies and T Cell Products, Katz, Hrsget al., (Boca Raton, Florida, CRC Press, Incet al., 1982), S 21-51, beschrieben, zu immumsieren. Milzzellen von diesen immunisierten Mäusen wurden mit SP2/0-Ag14-Myelomzeilen füsioniert unter Verwendung von Polyethylenglycol (PEG) 1500 (J.T. Baker Chemco, Phillisburg, New Jersey); die PEG-Lösungen für die Fusion wurden mindestens einen Monat vor der Verwendung hergestellt, um die Fusionseffizienz zu fördern. SP2/0-Ag14-Zellen produzieren nicht ihre eigenen Ig-Moleküle, wodurch eine Analyse des Isotyps und eine nachfolgende Reinigung erleichtert wird, solche Zellen erzeugen auch keine Retroviren. Die füsionierten Zellen wurden dann in 400 Millilitern von Dulbeccos Minimal-Grundmedium mit hohem Glucosegehalt (Flow Laboratories, Inc. Inglewood, Kalifornien) mit 10 % fötalem Kälberserum, 1,0 x 10&supmin;&sup6; molarem Hypoxanthin, 1 x 10&supmin;&sup6; molarem Methotrextat und 1,6 x 10&supmin;&sup6; molarem Thymidin resuspendiert. Als nächstes wurden die Zellen auf 30-Mikroliter-Platten plattiert und wie in Niman et al., Proc. Natl. Acad. Sci. USA (1982), siehe oben, beschrieben, herangezogen.

2. sis- und myb-verwandte Polypeptide

Die Polypeptide (c) und (d), deren Aminosäurereste den Positionen 139-155 der vorausgesagten Sequenz des transformierenden Proteins p28sis des Affenvirus und den Resten 2-18 der vorausgesagten Sequenz des Onkoproteins des Vogel-Myeloblastose-Virus entsprechen, wurden synthetisiert und an einen KLH-Träger, wie oben beschrieben, gekoppelt. Die auf diese Weise hergestellten Konjugate wurden bei etwa 50 Mikrogranim Polypeptid pro 129-GIX&spplus;- Maus pro Injektion verabreicht.

Am Tag 0 (Null) wurde jedes Konjugat mit komplettem Freundschem Adjuvans gemischt und intraperitoneal injiziert. Am Tag 19 wurde jedes Konjugat mit Alaun versetzt, um eine Konzentration von 5 Milligramm pro Milliliter an Alaun bereitzustellen, und intraperitoneal injiziert. Eine Booster-Injektion des Polypeptids (c) in Phosphat-gepufferter Salzlösung wurde intravenös am Tag 62 verabreicht. Serum, das oligoklonale Antikörper enthielt, wurde durch eine Orbital- bzw. Augenhöhlenpunktierung am Tag 67 entnommen. Nach einer zweiten, Alaun enthaltenden Immunisierung durch das Polypeptid (d) am Tag 41 wurde der Booster mit dem Polypeptid (d) auf eine ähnliche Weise am Tag 143 verabreicht, um in ähnlicher Weise oligoklonale Antikörper am Tag 148 bereitzustellen. Das auf diese Weise erhaltene Serum wurde bezüglich der Antigenität seiner Rezeptoren, wie in der Figur 4 erörtert, getestet.

In einer ähnlichen Weise wurden die Polypeptide, wie diejenigen, die den nachstehend aufgelisteten Aminosäurerest-Sequenzen entsprechen, synthetisiert.

abl LMRACWQWNPSDRPSF

fins FMQACWALEPTRRPTF

src LMCQCWRKDPEERPTF LGQGCFGEVWMG GSSKSKPKDPSQRRRS

fgr AMEQTWRLDPEERPTF

Die Immunisierung wurde in einer ähnlichen Weise, wie für die Aminosäurerest-Sequenzen von sis und myb beschrieben, durchgeführt.

3. ras- und erbB-verwandte Polypeptide

Die Polypeptide wie diejenigen, die in der Aminosäurerest-Sequenz den Resten 96-118 des ras-Polypeptids von der vorausgesagten Sequenz des ras-Onkogens des Kirsten-Mäuse- Sarkom-Virus und den Resten 366-381 des erbB-Polypeptids vom Vogel-Erythroblastom- Virus entsprechen, wurden synthetisiert und an einen KLH-Träger gekoppelt, wie oben beschrieben. Die auf diese Weise hergestellten Konjugate wurden bei etwa 50 Mikrogramm Polypeptid pro 129-GIX&spplus;-Maus pro Injektion verabreicht.

Am Tag 0 (Null) wurde jedes Konjugat mit komplettem Freundschem Adjuvans vermischt und intravenös injiziert. Am Tag 5 wurde Serum mit oligoklonalen Antikörpern durch eine Orbitalpunktierung entnommen. Das auf diese Weise erhaltene Serum wurde bezüglich der Antigenität seiner Rezeptoren, wie in der Figur 4 erörtert, getestet.

E. Antikörperbindungsassay

Anti-Polypeptid-Antikörper erzeugende Hybridome wurden mit einem Enzym-verknüpften Immunabsorptionsassay-(ELISA-) Verfahren, wie hierin in der Beschreibung der Figur 4 und in Niman et al., Monodonal Antibodies and T Cell Products, siehe oben, erörtert, nachgewiesen. Es wurden kurz gesagt etwa 50 Mikromol des Polypeptids auf Mikrotiterplatten getrocknet, mit Methanol fixiert und mit dem Überstand der Hybridom-Gewebekultur inkubiert. Nach gründlichem Waschen wurde die Bindung des Hybridomantikörpers unter Verwendung von Kaninchen-Anti-Maus-Kappa-Ketten-Antikörper (Litton Bionetics, Inc., Kensington, Maryland) gefolgt von einem mit Glucoseoxidase konjugierten Ziege-Anti- Kaninchen-Antiserum nachgewiesen. Die Bindung wurde mit dem Farbstoff 2,2'-Azino-di-[3- ethylbenzothiazolinsulfonat(6)] (ABTS) (Boehringer Mannheim, Indianapolis, Indiana) in Gegenwart von Glucose und Meerrettichperoxidase, wie in Niman et al., Monoclonal Antibodies and T Cell Products, siehe oben, beschrieben, sichtbar gemacht. Der Isotyp wurde durch das Ersetzen der Anti-Maus-Kappa-Kette durch verschiedene Kaninchen-Anti-Maus- Lambda- oder -Schwere-Kette-Seren, wie oben beschrieben, bestimmt.

F. Elektrophoretischer Transfer und iminunologischer Nachweis von Proteinen auf Nitrozellulose

Die Zellextrakte wurden einer Polyacrylamidgelelektrophorese unterzogen und das Protein wurde auf Nitrozellulose (Schleicher und Schuell, Inc. Keene, New Hampshire) transferiert, wie hierin in der Beschreibung von Figur 5 und in Niman et al., Virology 123:187-205 (1982) beschrieben. Mit Peroxidase markiertes Kaninchen-Anti-Maus-IgG-Serum (Tago Inc., Burlingame, Kalifornien), 1/1000 verdünnt, wurde mit den Transfers eine Stunde lang bei 25ºC inkubiert, gefolgt von Waschen, wie in Niman und Elder, Monodonal Antibodies and T Cell 20 Products, siehe oben, beschrieben. Der gebundene Antikörper wurde durch eine Inkubation in 1 Omillimolarem Tris (2-Amino-2-(hydroxymethyl)-1,3-propandiol), pH 7,4, 0,009 % H&sub2;O&sub2;, 0,0025 % 3,3'-Dimethoxybenzidindihydrochlorid (Eastman-Kodak Co., Rochester, New York) sichtbar gemacht.

G. Herstellung von gereinigtem PDGF

Sechzehn Einheiten gealterter Blutplättchen wurden von der San Diego Blutbank, San Diego, Kalifornien, erhalten. Das hierin verwendete, gereinigte PDGF wurde erhalten, indem den ersten beiden Schritten des in Antoniades et al., Proc. Natl Acad Sci. USA 76:1 809-1 813 (1979) beschriebenen Verfahrens gefolgt wurde.

Es wurden, kurz gesagt, die Blutplättchen durch 20 Minuten langes Zentrifügieren bei 28 000 x Schwerkraft (g) bei 4ºC gesammelt. Die erhaltenen Blutplättchen wurden durch Resuspendieren in 400 Millilitern einer Mischung gewaschen, die (a) 9 Volumina 17millimolaren Tris-HCl bei einem pH von 7,4 einschließlich von 0,1 Smolarem NaCl und 1 % Glucose enthielt, und (b) ein Volumen einer Lösung, die pro 100 Millilitern einschließt: 0,8 Gramm Zitronensäuremonohydrat, 2,2 Gramm wasserfreie Dextrose und 2,6 Gramm Natriumcitratdihydrat, gefolgt von einer weiteren 10 Minuten langen Zentrifügation bei 28 000 x g bei 4ºC. Die auf diese Weise gewaschenen Blutplättchen wurden dann in 16 Millilitern einer wäßrigen Lösung, die 0,008molares NaCl und zu 0,01molar Phosphationen bei einem pH-Wert von 7,4 (NaCl-Phosphationen-Lösung) enthielt, resuspendiert und 10 Minuten lang gekocht, um die Zellen zu lysieren.

Die Proteaseinhibitoren Phenylmethylsulfonylfluorid und Traysylol (Sigma Chemical Co., St. Louis, Missouri) wurden zu den lysierten Zellen in Konzentrationen von imillimolar bzw. 3 % zugegeben. Die Mischung der lysierten Zellen wurde wiederum zentrifügiert, um ein Pellet und einen Überstand bereitzustellen.

Der Überstand wurde mit 8 Millilitern CM Sephadex C-50-Kügelchen (Pharmacia Fine Chemicals, Piscataway, New Jersey) gemischt, die zuvor in der NaCl-Phosphationen-Lösung äquilibriert worden waren. Die Kügelchen und die Flüssigkeit wurden in eine Chromatographiesäule (15 x 1,5 cm) gegeben, die mit 6 Säulenvolumina der oben genannten NaCl- Phosphationen-Lösung gewaschen wurde. Das PDGF, erstes Eluat, wurde durch das Eluieren der Säule mit zwei Säulenvolumina von 1 molarem NaCl erhalten. Traysylol wurde dem Eluat zugegeben, um eine Endkonzentration von 3 % bereitzustellen und das Eluat wurde gegen die obengenannte NaCl-Phosphationen-Lösung dialysiert.

Das obenstehend hergestellte, lysierte Zelipellet wurde mit 1 molarer NaCl-Lösung 24 Stunden lang bei 4ºC extrahiert und zentrifügiert. Der Überstand wurde gegen die obengenannte NaCl- Phosphationen-Lösung dialysiert, mit dem obengenannten Sephadex versetzt und in eine Säule gebracht. Die Säule wurde gewaschen und wie oben eluiert, um ein zweites Eluat bereitzustellen, das wie oben dialysiert wurde. Das in diesem Verfahren hergestellte Pellet wurde auf dieselbe Weise behandelt, um ein drittes Eluat bereitzustellen, das wiederum wie vorstehend besprochen dialysiert wurde.

-Die drei dialysierten Eluate wurden vereinigt und unter Verwendung einer Amicon Ultraflltrations-Vorrichtung (Amicon, Lexington, Massachusetts) und eines Filters mit einem Aussschluß von 10 kD auf ein Volumen von wenigen Millilitern konzentriert. Das so gereinigte PDGF wurde dann, wie für die Figur 5 besprochen, behandelt.

Der gereinigte PDGF-Extrakt aus etwa 2,5 Einheiten von Blutplättchen wurde mit einem minimalen Volumen einer Lösung, die 0,5 Prozent Natriumdodecylsulfat (SDS) und 5 Prozent 2-Mercaptoethanol enthielt, gemischt. Die resultierende Mischung wurde zwei Minuten lang gekocht und dann durch ein 5-17prozentiges Polyacrylamidgel hindurch der Elektrophorese unterzogen. Das Protein wurde danach elektrophoretisch auf Nitrozellulose transferiert; (Niman und Elder, siehe oben). Diese wurde danach im Anschluß an das Western-Blot- Verfahren in Streifen geschnitten.

Die so hergestellten Nitrozellulosestreifen wurden dann mit einer 3 Prozent Rinderserum albumin (BSA), 0,1 Prozent Polyoxyethylen-9-octylphenylether (Triton X- 100) in Phosphatgepufferter Salzlösung enthaltenden Lösung behandelt, um eine unspezifische Bindung von Protein zu hemmen. 4 Milliliter Mäuseantiserum, 1:200 verdünnt, wurden dann mit den Nitrozellulosestreifen inkubiert.

Nach dreimaligem Waschen mit einer Lösung von 0,1 Prozent Triton X-100 in PBS wurden die Nitrozellulosestreifen entweder mit 106 Impulsen pro Minute (cpm) ¹²&sup5;I-markiertem Protein von Staphylococcus aureus oder einer Verdünnung von 1:1000 von mit Peroxidase konjugiertem Ziege-Anti-Maus-Serum (Tago) inkubiert und wiederum mit 0,1 Prozent Triton X- 100 in PBS gewaschen. Das Peroxidasekonjugat wurde mit einer Lösung aus 0,0009 Prozent H&sub2;O&sub2;, 0,0025 Prozent 3,3'-Dimethoxybenzidindihydrochlorid (Eastman-Kodak, Co.) in einem 10 millimolaren Trispuffer mit einem pH-Wert von 7,4, entwickelt. Die ¹²&sup5;I-markierten Streifen wurden durch Exposition auf einem XRP-1-Film (Eastman-Kodak, Co.) unter Verwendung von Cronex-Hi-Plus-Verstärkerschirmen (E.I. DuPont de Nemours & Co.) bei -70ºC während 48 Stunden entwickelt.

H. Urin-Assay

Der Urin wurde von den Spendern (Patienten), wie in der Beschreibung der Figuren vermerkt, gesammelt und verwendet, wie gesammelt, oder 40-fach unter Verwendung einer Amicon Ultrafiltrations-Vorrichtung konzentriert. Diese Flüssigkeit wurde in dem Assay auf Proteine, die codiert von oder verwandt mit den Onkogenen 515, fes und ras sind, verwends das Aliquot der Probe einer Körperflüssigkeit.

Die konzentrierte Urinprobe wurde auf die folgende Weise hergestellt. Der Urin wurde bei 6 000 U/min bei 4ºC 10 Minuten lang geklärt. Der Überstand wurde dann unter Verwendung eines Amicon-Filters mit einem Ausschluß von 10 000 Dalton konzentriert. Dieser konzentrierte Urin wurde dann dialysiert, um die Proteinfraktionen zu trennen.

Der konzentrierte Urin wurde zu 25 Mikrolitern pro Spur in einem 5-17prozentigen Polyacrylamidgel einer Elektrophorese unterzogen, um das Äquivalent des Proteins von 1 Milliliter des gesammelten Urins bereitzustellen und dann elektrophoretisch auf Nitrozellulose gebracht. Der Nitrozellulosefilter wurde dann mit einer Verdünnung von 1/200 von zum Beispiel Mäuse-Antiserum in einer Lösung von 3 % Rinderserumalbumin, 0,1 % Triton X- 100 und PBS sondiert. Der Nitrozellulosefilter wurde dann dreimal gewaschen und mit 10&sup6; cpm des ¹²&sup5;I-markierten Protein A inkubiert.

Die Bindung wurde mit Verstärkerschirmen bei -70ºC, wie in der vorstehend beschriebenen Figur 6, sichtbar gemacht.

I. Onkoproteine und transformierte Zeilen

NRK- und SSV-transformierte NRK-Zellen wurden von S.A. Aaronson und K.C. Robbins vom Centerfor Cancer Research, National Institutes ofhealth, Bethesda, MD, bereitgestellt. Die Zellen wurden in Dulbeccos minimalem Grund-Medium, supplementiert mit 10 % fötalem Kälberserum, 2millimolarem L-Glutamin, 100 IU Penicillin pro Milliliter und 100 Mikrogramm Streptomycin pro Milliliter, herangezogen.

Parallelkulturen von NRK- und SSV-transformierten NRK-Zellen wurden dreimal während zweistündiger Intervalle gewaschen und wurden dann 18 Stunden lang in Medium ohne Serum zu 15 Millilitern pro T75-Centimeter²-Flasche inkubiert. Das auf diese Weise konditionierte Medium wurde dann zentrifligiert und wurde gefroren bei -70ºC gelagert.

Das konditionierte Medium wurde aufgetaut, 500-fach unter Verwendung einer Dialyse in imolarer Essigsäure konzentriert und wurde danach lyophilisiert. Nach der Solubilisierung und einer Reduktion mit 10 %igem 2-Mercaptoethanol, wurden 50 Mikroliter der konzentrierten, konditionierten Medien in einem 5-17%igen Natriumdodecylsulfat-Polyacrylamidgel einer Elektrophorese unterzogen. Die sezernierten Proteine wurden dann elektrophoretisch transferiert und an Nitrozellulose gebunden. Eine unspezifische Bindung wurde durch eine Vorinkubation des Zellextraktes mit einer 3 % Rinderserumalbumin und 0,1 % Polyoxyethylenoctylphenylether in Phosphat-gepufferter Salzlösung mit einem pH-Wert von 7,4 enthaltenden Lösung blockiert.

Vor der Ausführung der immunologischen Assays wurden 20 Mikroliter der Mäuse-Antiseren, die durch PDGF-2 (1-18) oder PDGF-2 (73-89) (vorstehend beschrieben) induziert worden waren, mit 100 Mikrogramm eines geeigneten Polypeptids 1 Stunde lang bei 37ºC vorinkubiert. Die oligoklonalen Antikörper/Polypeptid enthaltende Reaktionsmischung wurde dann 1:500 mit der obengenannten Vorinkubationslösung verdünnt. Die auf diese Weise hergestellte verdünnte Lösung wurde dann bei 4ºC mit den Nitrozellulose-gebundenen, konditionierten Medien in Kontakt gebracht, und dieser Kontakt wurde während eines Zeitraums von 15 Minuten aufrechterhalten (inkubiert), einer Zeit, die hinreichend ist für die Immunreaktion des Antikörpers (Rezeptors) und des an die Nitrozellulose gebundenen Proteins. Die Nitrozellulose wurde danach gewaschen.

Die gewaschene Nitrozellulose wurde dann mit den 1:500 verdünnten affinitätsgereinigten Kaninchen-Anti-Maus-IgG&sub1;-Antikörpern (Litton) bei 25ºC in Kontakt gebracht. Der Kontakt wurde während eines Zeitraums von 2 Stunden aufrechterhalten, hinreichend, damit die Anti- Maus-IGgG&sub1;-Antikörper mit den Antikörpern aus den Antiseren, die an die Nitrozellulosegebundenen sezernierten Proteine der konditionierten Medien gebunden hatten, eine Immunreaktion eingehen. Die Nitrozellulose wurde dann erneut gewaschen.

Die Immunreaktion (das Binden) wurde mit 106 cpm 1251-markiertem Protein A von Staphybcoccus aureus, wie in Niman, Nature 307:180-183 (1984) beschrieben, sichtbar gemacht.

Die Regierung der Vereinigten Staaten hat Rechte an dieser Erfindung, gemaß Public Health Service Contract NO1-CP-41 009, Public Health Service Grants CA 38 160 und CA 25 803.


Anspruch[de]

1. Verfahren zur Charakterisierung einer ersten biologischen Probe aus einem Individuum zum Zwecke der Überwachung einer Krebstherapie bei dem Individuum, umfassend die Schritte:

(a) Kontaktieren der ersten biologischen Probe mit mindestens zwei unterschiedlichen monokionalen Rezeptormolekülen, welche beide an (i) einen durch ein Onkogen exprimierten Proteinliganden und (ii) ein Polypeptid mit einer Aminosäurerest-Sequenz, die etwa 7 bis 40 Aminosäuren, welche einem Abschnitt des Proteinliganden entsprechen, enthält, binden, wobei die monokionalen Rezeptormoleküle gegen ein das Polypeptid enthaltendes Immunogen gezogen wurden, um ein erstes Reaktivitätsmuster zu erzeugen;

und

(b) Vergleichen des ersten Reaktivitätsmusters mit einem zweiten Reaktivitätsmuster, welches durch eine bekannte biologische Probe erzeugt wurde, wobei das zweite Muster die Onkogenexpression oder die Expression Onkogen-verwandter Sequenzen durch das Individuum am Anfang der Therapie anzeigt.

2. Verfahren gemäß Anspruch 1, wobei das erste Reaktivitätsmuster erzeugt wird durch Kontaktieren einer Vielzahl von Aliquots der ersten biologischen Probe mit jeweiligen Vertretern einer Reihe von unterschiedlichen monokionalen Rezeptormolekülen, Liganden der Aliquots elektrophoretisch aufgetrennt und einem festen Träger zugeführt worden sind und das zweite Reaktivitätsmuster erzeugt wird durch die Verwendung der monokionalen Rezeptormoleküle, die zur Erzeugung des ersten Reaktivitätsmusters verwendet wurden.

3. Verfahren gemäß Anspruch 1 oder 2, wobei mindestens eines der monokionalen Rezeptormoleküle sezerniert wird durch ein bei der ATCC hinterlegtes Hybridom, gewählt aus:

4. Verfahren gemäß einem der Ansprüche 1 bis 3, wobei die erste biologische Probe abgeleitet ist von einem Tumor und die Charakterisierung auf die Anwesenheit oder die Krankheitsschwere des Krebses bezogen ist.

5. Verfahren gemäß einem der Ansprüche 1 bis 3, wobei die erste biologische Probe abgeleitet ist von einem Tumor und die Charakterisierung auf die Entwicklungsstufe bezogen ist.

6. Verfahren gemäß einem der Ansprüche 1 bis 3, wobei die erste biologische Probe Urin ist und die Charakterisierung auf die Anwesenheit oder die Krankheitsschwere des Krebses bezogen ist.

7. Verfahren gemäß einem der Ansprüche 1 bis 3, wobei die erste biologische Probe Urin ist und die Charakterisierung auf die Entwicklungsstufe bezogen ist.

8. Verfahren gemäß einem der vorhergehenden Ansprüche, wobei das erste Reaktivitätsmuster mit dem zweiten Reaktivitätsmuster unter Anwendung eines automatischen Scanners verglichen wird.

9. Kit, welches zum Zwecke des Überwachens eines eine Krebstherapie erfahrenden Individuums zu verwenden ist, umfassend (i) ein Reaktivitätsmuster, das durch Kontaktieren einer biologischen Probe aus einem normalen Individuum mit mindestens zwei unterschiedlichen monoklonalen Rezeptormolekülen erzeugt wird, wobei beide monoklonalen Rezeptormoleküle an (i) einen durch ein Onkogen exprimierten Proteinliganden und (ii) ein Polypeptid mit einer Aminosäurerest-Sequenz, die etwa 7 bis 40 Aminosäuren, welche einem Abschnitt des Proteinliganden entsprechen, enthält, binden, wobei die monoklonalen Rezeptormoleküle gegen ein das Polypeptid enthaltendes Immunogen gezogen wurden, und (ii) Behälter der monoklonalen Rezeptormoleküle.

10. Kit gemaß Anspruch 9, wobei mindestens eines der monoklonalen Rezeptormoleküle sezerniert wird durch ein bei der ATCC hinterlegtes Hybridom, gewählt aus:

11. Kit gemaß Anspruch 9 oder 10, wobei das Reaktivitätsmuster durch einen automatischen Scanner ausgewertet wird.

12. Kit gemaß einem der Ansprüche 9 bis 11, welches ferner ein Computerprogramm zur Verwendung beim Vergleich des Reaktivitätsmusters mit einem Reaktivitätsmuster, das durch Kontaktieren einer unbekannten biologischen Probe mit mindestens zwei monoklonalen Rezeptormolekülen, die in dem Kit eingeschlossen sind, erzeugt wird, umfaßt.







IPC
A Täglicher Lebensbedarf
B Arbeitsverfahren; Transportieren
C Chemie; Hüttenwesen
D Textilien; Papier
E Bauwesen; Erdbohren; Bergbau
F Maschinenbau; Beleuchtung; Heizung; Waffen; Sprengen
G Physik
H Elektrotechnik

Anmelder
Datum

Patentrecherche

  Patente PDF

Copyright © 2008 Patent-De Alle Rechte vorbehalten. eMail: info@patent-de.com