PatentDe  


Dokumentenidentifikation DE69230769T2 13.07.2000
EP-Veröffentlichungsnummer 0671947
Titel ZUSAMMENSETZUNGEN ZUM AUSLÖSEN CYTOTOXISCHER T-LYMPHOZYTEN GEGEN VIREN
Anmelder Board of Regents, The University of Texas System, Austin, Tex., US
Erfinder SASTRY, K., Jagannadha, Houston, US;
ARLINGHAUS, B., Ralph, Bellaire, US;
PLATSOUCAS, D., Chris, Houston, US;
NEHETE, N., Pramod, Houston, US
Vertreter Patent- und Rechtsanwälte Bardehle, Pagenberg, Dost, Altenburg, Geissler, Isenbruck, 81679 München
DE-Aktenzeichen 69230769
Vertragsstaaten AT, BE, CH, DE, DK, ES, FR, GB, GR, IE, IT, LI, LU, MC, NL, PT, SE
Sprache des Dokument EN
EP-Anmeldetag 02.12.1992
EP-Aktenzeichen 939007704
WO-Anmeldetag 02.12.1992
PCT-Aktenzeichen US9210378
WO-Veröffentlichungsnummer 9310816
WO-Veröffentlichungsdatum 10.06.1993
EP-Offenlegungsdatum 20.09.1995
EP date of grant 08.03.2000
Veröffentlichungstag im Patentblatt 13.07.2000
IPC-Hauptklasse A61K 39/21
IPC-Nebenklasse A61K 39/12   C12Q 1/02   

Beschreibung[de]
1. Gebiet der Erfindung

Die vorliegende Erfindung betrifft auf allgemeine Weise die Prävention und Behandlung von AIDS und Verfahren und Zusammensetzungen zum Primen spezifischer zytotoxischer T-Lymphozyten (CTL)-Reaktionen in vivo. Verfahren zur Identifizierung von Kandidatensubstanzen, typischerweise Polypeptiden, zur Verwendung bei der Herstellung von CTL-Vakzinen werden beschrieben. Peptidformulierungen werden offenbart, die die systemische Verteilung, Aktivität und Langlebigkeit der anti-viralen zytotoxischen T-Zellen verstärken und/oder menschliche Zellen vor einer HIV-Infektion schützen.

2. Beschreibung des verwandten Standes der Technik

AIDS wurde zunächst in den Vereinigten Staaten 1981 erkannt; die Zahl der Fälle hat sich mit einer dramatischen Geschwindigkeit seit damals erhöht. Seit 1978 sind mehr als über 2,4 Millionen AIDS-Infektionen in den Vereinigten Staaten allein berichtet worden (Rees, 1987). Sobald signifikante immunsuppressive Symptome bei einem infizierten Individuum in Erscheinung treten, ist das erwartete Ergebnis der Infektion der Tod. Es gibt gegenwärtig keine bekannte Behandlung, die unbegrenzt die fatalen Konsequenzen dieser Krankheit verzögern oder diesen vorbeugen kann. Obwohl sich die Krankheit zuerst bei homosexuellen oder bisexuellen Männern und Menschen mit intravenösem Drogenmißbrauch manifestierte, hat sie sich nun mittels z. B. intimem sexuellen Kontakt oder Erhalt von Blutprodukten eines Virusträgers ausgebreitet.

Das verursachende Agens, das mit AIDS assoziiert ist, ist als eine Gruppe von nahe verwandten Retroviren identifiziert worden, die gemeinhin als humaner T- Zell lymphotropischer Virus Typ III (HTLV III), Lymphadenopathie-Viren (LAV), Aids-verwandten Viren (AIDS-Related Viruses; ARV) bekannt sind oder in jüngerer Zeit menschlicher Immundefizienz-Virus (HIV) genannt wurde. Auf diese Viren wird hierin aus Gründen der Zweckmäßigkeit gemeinsam als HIV bezug genommen werden.

Wie andere Retroviren besitzt HIV RNA als sein genetisches Material. Wenn der Virus in die Wirtszelle eintritt, kopiert ein virales Enzym, das als Reverse Transkriptase bekannt ist, die virale RNA in eine doppelsträngige DNA. Die virale DNA wandert in den Kern der Zelle, wo sie als eine Matrize für zusätzliche Kopien der viralen RNA dient, die dann in neue virale Partikel zusammengesetzt werden kann. Die virale RNA kann auch als Boten-RNA (messenger RNA; mRNA) für bestimmte virale Proteine dienen, einschließlich der viralen Kernproteine p18, p24, p13, und Reverse Transkriptase. Die RNA kann auch in spezifische virale mRNAs "gespleisst" werden, die notwendig sind zum Erzeugen verschiedener anderer viraler Proteine einschließlich zweier glykosylierter Strukturproteine, die als gp41 und gp120 bekannt sind, die in die äußere Membran des Virus eingesetzt werden (Wain-Hobson et al., 1985). Es ist bekannt, daß gereinigtes gp 120 Antikörper in der Ziege, dem Pferd und dem Rhesusaffen induziert, die HIV in Labortests neutralisieren (Robey et al., 1986).

Seit vielen Jahren sind Vakzine eingesetzt worden, um Infektionen vorzubeugen, die durch Agentien wie Viren verursacht werden. Die allgemeine Herangehensweise bestand darin, gesunden Individuen beispielsweise eine getötete oder modifizierte Viruspräparation zu injizieren, um die Immunsysteme des Individuums zu primen, um einen Angriff gegen das infizierende Virus zu führen. Jüngste Fortschritte der rekombinanten DNA-Technologien haben sicherere Verfahren der Impfung erlaubt, die die Verwendung von exponierten viralen Bestandteilen beinhalten, die durch mikrobielle Systeme erzeugt wurden. Nach ausreichender Reinigung wird der virale Bestandteil, z. B. eine Protein-Untereinheit, als eine Vakzine in einem geeigneten Vehikel und/oder einem Adjuvants verabreicht. Letztere sti muliert das Wirtssystem derart, daß es die Immunantwort gegen die virale Untereinheit verbessert. Ein anderes potentielles Verfahren zur Herstellung einer Vakzine besteht in dem Einsatz chemisch synthetisierter Peptidfragmente einer viralen Proteinuntereinheit. Dieses Verfahren besitzt gegenüber anderen Verfahren zur Herstellung von Vakzinen mehrere Vorteile einschließlich der Reinheit des Produkt, der Reproduzierbarkeit und der Spezifität der Immunantwort.

Oberflächenantigene eines infizierenden Virus können T-Zell- und B-Zell- Antworten/Reaktionen hervorrufen. Aus der Arbeit von Milich und Mitarbeitern (Milich et al., 1986; Milich & McLachlan, 1986) ist deutlich geworden, daß einige Regionen der Peptidkette eines Proteins entweder T-Zell- oder B-Zell-Epitope besitzen können. Diese Epitope sind häufig voneinander deutlich verschieden und können verschiedene Peptidsequenzen umfassen. Andere Beispiele schließen die Arbeit von Maizel et al., (1980) für Lysozym aus Hühnereiweiß und die von Senyk et al., (1971) für Glucagon ein. Kurze Stücke einer Proteinsequenz können also eine T-Zell-Antwort aber nicht eine B-Zell-Antwort hervorrufen. Eine vollständigere Übersicht über diese und andere Beobachtungen, die für diesen Punkt relevant sind, ist in der Arbeit von Livingstone & Faithman (1987) enthalten.

Es ist gezeigt worden, daß eine große Peptidregion innerhalb des Oberflächenproteins des infektiösen Hepatitis B-Virus nur eine T-Zell-Antwort in Mäusen hervorrufen kann (Milich et al., 1986). Auf spezifische Weise rief ein synthetisches Peptid, dessen Sequenz aus den Aminosäuren mit den Nummern 120-132 stammt, die innerhalb der prä-S(2)-Domäne des Hepatits B-Oberflächenantigen- Gens liegt, eine sehr starke T-Zell-Priming-Antwort auf das Peptid, aber nur eine sehr schwache Antikörperantwort stimulierte. In anderen Worten, Mäuse zeigten nur eine schwache Antikörperantwort gegen das Peptid, aber die T-Zellen der immunisierten Mäuse waren auf effiziente Weise zum Erkennen des Peptids geprimt (d. h. aktiviert), wie in einem T-Zell-Proliferationsassay gemessen wurde (Milich et al., 1986). Der niedrige Wert des Antikörpers, der durch Mäuse erzeugt wurde, die mit diesem Peptid immunisiert worden waren, band nicht das native virale Oberflächenantigen. Im Gegensatz zu den zuvor beschriebenen Ergebnissen rief eine zweite Peptidsequenz (Aminosäuren 132-145) eine sehr schwache T-Zell- Antwort in Mäusen hervor (Milich et al., 1986). Dieses zweite Peptid band jedoch auf wirksame Weise einen gegen es gerichteten Antikörper unter Bedingungen, bei denen ein T-Zell-Epitop bereitgestellt wird.

Mäuse wurden ebenfalls mit einem längeren Peptid immunisiert, das aus beiden der zuvor erwähnten T- und B-aktiven Peptidsequenzen bestand. In diesem Fall wurden hohe Titer an Antikörpern gegen das B-Stellen-Peptid, aber nicht das T- Stellen-Peptid erzeugt. Die Kombination von sowohl T- als auch B-Stellen innerhalb eines Peptids sollte sowohl T- als auch B-Zell-Antworten stimulieren, wie durch Erzeugen eines spezifischen Antikörpers gegen das B-Zell-Epitop der Peptidkette gemessen wurde. Es können synthetische Peptidantigene konstruiert werden, um zwei Arten von Immunantworten zu erzeugen: Eine T-Zell-Antwort allein, und eine T-Zell-Antwort kombiniert mit einer B-Zell-Antwort.

Zelluläre Immunantworten stellen einen Hauptmechanismus bereit zum Reduzieren des Wachstums von virusinfizierten Zellen (Doherty et al., 1985). Ein Bericht von Earl et al. (1986) zeigte ein Primen von T-Lymphozyten und einen Schutz gegen eine Maus-Leukämie, die durch das Friend-Virus (ein Retrovirus) induziert wird, durch eine Vakzine eines viralen Oberflächenproteins. Kürzlich wurde ein direkter Hinweis auf die Rolle einer Untergruppe von T-Lymphozyten (OKT8/LEU2-positiv) bei der Unterdrückung von HIV-Wachstum in vitro durch Walker et al. (1986) erhalten. Diese Studie zeigte weiterhin, daß, nach Verringerung von CD8&spplus;-T-Lymphozyten aus dem Blut von HIV-infizierten Individuen, große Mengen an HIV aus den mononukleären Zellen des peripheren Bluts von 4 von 7 asymptomatischen, seropositiven homosexuellen Männern isoliert wurden, die anfänglich Virusnegativ waren oder sehr geringe Viruswerte besaßen. Somit können die CD8&spplus;-zytotoxischen T-Lymphozyten (CTLs) eine Rolle bei Virusinfizierten Individuen zum Vorbeugen einer HIV-Replikation oder des Fortschreitens der Krankheit spielen.

Das Konzept des Identifizierens von T-Zell-Epitopen in Proteinen zum Einschluß in potentielle Kandidaten einer Vakzine hat an Bedeutung gewonnen als Ergebnis des Befunds von Townsend et al. (1986), daß CTL-Epitope des Influenza- Nukleoproteins durch kurze synthetische Peptide definiert werden können. Bisher gibt es jedoch nur drei dokumentierte Fälle (Deres et al., 1989; Aichele et al., 1990; Kast et al., 1991), die die Verwendung von synthetischen Peptiden bei dem in vivo-Primen von CTLs beschreiben; diese beziehen sich auf Influenza-, Sendai- und Lymphozyten-Choriomeningitis-Viren. In jedem der vorliegenden Fälle sind die Immunisierungsprotokolle beschwerlich, erfordern entweder Modifikationen von Peptiden oder viele durchzuführende Immunosierungen zum Zeigen von CTLs und eignen sich nicht für das schnelle Durchmustern einer großen Anzahl von Kandidatensubstanzen. Z. B. beinhaltet das Verfahren von Aichele und Mitarbeitern (1990) drei Immunisierungen über den subkutanen Weg in Intervallen von einer Woche, und es dauert vier Wochen, bevor potentielle CTLs für einen Assay erhalten werden.

Kandidaten-CTL-Epitope in sowohl Struktur- als auch Regulator-HIV-Proteinen sind vorgeschlagen worden (Takahashi et al., 1988; Nixon et al., 1988), aber von keinem dieser ist gezeigt worden, daß sie Virus-spezifische CTLs in vivo induzieren können (Berzofsky, 1991). Obwohl z. B. das Peptid RIQRGPGRAFVTIGK als ein CTL-Epitop identifiziert worden ist (Takahashi et al., 1988), wurde in diesen Studien die in vivo-Induktion der Sequenz RIQRGPGRAFVTIGK-spezifischen CTLs erreicht, indem BALB/c-Mäuse mit rekominantem Vaccinia-Virus, das HIV-env-Proteine exprimierte, infiziert wurden (Takahashi et al., 1988), und Versuche bei der Immunisierung mit freiem Peptid sind nicht erfolgreich gewesen (Berzofsky, 1991). Hart et al. (1991) waren ebenfalls nicht in der Lage, CTL- Antworten auf eine Immunisierung mit einem einzelnen Peptid, das die CTL- Epitop-Sequenz, CTRPNNNTRKSIRIQRGPGRAFVTI, besaß, zu bilden.

Die der Induktion von Peptid-induzierten CTL-Antworten in vivo zugrunde liegenden Mechanismen sind bisher nicht voll verstanden worden. Gao et al. (1991) berichteten beispielsweise, daß die Zugabe einer T-Helferzell-Determinante zu einer CTL-Determinante, um ein Hybridpeptid zu bilden, die CTL-Bildung gegen Influenza-Virus nicht verstärkte. Diese Ergebnisse lassen vermuten, daß die Induktion von T-Helferzellen-Aktivität für eine wirksame CTL-Bildung nicht auf spezifische Weise benötigt wird, obwohl die gleichen Studien zeigten, daß die Verminderung von CD&spplus;-Zellen die CTL-Bildung in Antwort auf Peptide hemmte.

Somit bleibt ein Bedarf an sowohl der Entwicklung von Verfahren zur schnellen Identifizierung von CTL-Epitopen, die die Fähigkeit zum Induzieren einer spezifischen CTL-Antwort in vivo besitzen, als auch an der Optimierung einer CTL- Induktion bestehen. Vorherige Assay-Verfahren zur Indentifizierung von CTL- induzierenden Epitopen, die in vivo wirken, leiden an einer Reihe von Nachteilen. Die bemerkenswertesten hiervon sind: Das Erfordernis von vielen Injektionen des zu testenden Stoffs, eine Wartezeit von bis zu 3 Wochen oder länger zur Bestimmung, ob die Substanz eine positive Wirkung auf die CTL-Antwort besaß, und die allgemeine Notwendigkeit einer Aufnahme eines Modifikators mit der zu testenden Substanz, um eine Antwort hervorzurufen. Es ist deutlich, daß ein schnelles Verfahren zum Entwerfen von Peptiden mit einer in vivo-CTL-induzierenden Fähigkeit von vitaler Bedeutung für das Entwerfen von präventiven und therapeutischen Strategien in bezug auf eine große Vielzahl von Krankheiten ist.

Dem Stand der Technik fehlt weiterhin ein wirksames Verfahren der Erzeugung einer systemischen, langlebigen CTL-Antwort auf hohem Niveau in Folge einer Peptidimmunisierung. Die Entwicklung eines Verfahrens zur Verstärkung der Bildung und systematischen Verteilung von anti-viralen CTL-Zellen in Tieren oder Menschen würde von großem Vorteil für die Entwicklung von Vakzinen gegen infektiöse virale Agentien sein. Nicht nur würde ein derartiges Verfahren eine wichtige Waffe zum Einsatz gegen Viren, einschließlich AIDS und Influenza, sein, sondern sie würde auch auf eine Impfung gegen andere Agentien wie Parasiten anwendbar sein.

Obwohl es bekannt ist, daß die gp120-V3-Loop-Region essentiell für den Eintritt von HIV-1 in die Zellen ist (Travis et al., 1991; Freed & Riser, 1987; Freed et al., 1991), hat dieses Wissen bisher noch nicht zu der Entwicklung einer wirksamen klinischen Strategie zur Vorbeugung einer HIV-Infektion geführt. Es ist berichtet worden, daß V3-abgeleitete synthetische Peptide die Bildung eines Syncytiums zwischen den HIV-1-infizierten Zellen inhibieren, aber nur bei Konzentrationen von 100-300 uM (Koito et al., 1989). Im Gegensatz dazu haben De Rossi et al. (1991) berichtet, daß V3-abgeleitete synthetische Peptide tatsächlich die HIV-1- Infektion von Zellen durch einen CD4-abhängigen Mechanismus verstärken. Zusätzlich zu dem deutlichen Fehlen einer geeigneten Vakzine gegen HIV gibt es deshalb gegenwärtig kein wirksames Mittel zum Anhalten einer viralen Infektion und zur Verhinderung des Fortschreitens der Krankheit in HIV-infizierten Individuen.

Berzofsky (1991) schlägt eine künstliche HIV-Vakzine vor, die antigenische Epitope umfaßt, die neutralisierende Antikörper, T-Helferzellen und CD8&spplus;- zytotoxische-T-Zellen hervorrufen.

Gao et al. (1991) beschreiben, daß eine Immunisierung mit einem Hybridpeptid, das ein CTL-Epitop und ein T-Helferzell-Epitop beinhaltet, nicht zur Verstärkung von CTL-Antworten führt, wenn dies mit einer CTL-Antwort durch das CTL- Peptid allein verglichen wird.

Berzofsky et al., AIDS Research and Human Retroviruses, Annual Meeting of the National Cancer Institute Laboratory of Tumor Cell Biology, Maryland, USA, 11.- 17. August 1990, Band 7, New York, Seite 144, beschreiben das Vorliegen eines CTL- und eines T-Helferzell-Epitops auf dem gleichen Peptid, d. h. nicht auf ge trennten Peptiden, und erwähnen nicht die Aufnahme eines getrennten HIV- Infektions-inhibierenden Peptids.

EP-A-0 433 242 betrifft die Induktion von neutralisierenden Antikörpern und auf spezifische Weise die Stimulierung von Antikörperinduzierenden Th2- Helferzellen, aber nicht die Verwendung von getrennten Peptiden mit verschiedenen Funktionen.

WO 91/04045 offenbart ein Peptid-Multimer zur Verwendung bei der Induzierung eines zytotoxischen T-Zell-Aktivators gegen natives HIV-Protein.

Zusammenfassung der Erfindung

Die vorliegende Erfindung befaßt sich mit einem oder mehreren der vorgenannten oder anderen Nachteilen im Stand der Technik durch Bereitstellen mehrerer neuer Zusammensetzungen und Verfahren zum Hervorrufen von Immun- oder Anti- Infektionsantworten. Die Erfindung stellt spezifische Zusammensetzungen und Verfahren zur Immunisierung gegen virale Krankheiten, und insbesondere zur Immunisierung gegen HIV bereit. Die verbesserten Immunisierungszusammensetzungen oder Vakzine der Erfindung umfassen synthetische Peptidkombinationen, die die systemische Verteilung, das Aktivitätsniveau und die Langlebigkeit der virusspezifischen zytotoxischen T-Zellen (CTLs) verstärken.

Die vorliegende Erfindung stellt therapeutische Zusammensetzungen und Verfahren zur Verwendung bei der Inhibierung der HIV-Infektion bereit. Die therapeutischen Formulierungen der Erfindung umfassen synthetische Peptide, die den Schutz von menschlichen Zellen gegen eine HIV-Infektion bewirken. Die vorliegende Erfindung umfaßt daher auf breite Art und Weise antivirale und insbesondere anti-HIV-Zusammensetzungen, die sowohl präventive wie therapeutische Anwendungen besitzen.

Eine Immunisierung und Assay-Verfahren für das schnelle und sensitive Durchmustern einer großen Anzahl von Kandidaten-Verbindungen wie Peptiden zur Identifizierung solcher, die die Fähigkeit besitzen, auf spezifische Weise eine CTL-Antwort zu primen, und die deshalb am geeignetsten zur Verwendung in therapeutischen Zusammensetzungen wie CTL-induzierenden Vakzinen sind, werden ebenfalls beschrieben. Dieser Aspekt betrifft auf allgemeine Weise Verfahren und Zusammensetzungen zur Identifizierung von Bestandteilen von Vakzinen, die die Fähigkeit besitzen, auf spezifische Weise CTLs zu primen, um sie so gegen Zellen reaktiv zu machen, die infektiöse Agentien wie Viren, einschließlich HIV- und Influenza-Viren beherbergen.

In Hinsicht auf die Verstärkung von CTL-Antworten betrifft die vorliegende Erfindung Zusammensetzungen und Verfahren zum Verstärken der CTL-Antwort eines Tieres auf ein gegebenes Immunogen und insbesondere ein CTL- induzierendes Peptid. Ein CTL-induzierendes Peptid ist ein Peptid, das ein CTL- induzierendes Epitop trägt, das in der Lage ist, die Bildung von spezifischen zytotoxischen T-Zellen zu stimulieren oder deren Aktivität zu erhöhen im Anschluß an ihre Verabreichung an ein Tier. Der Begriff "Verstärken der CTL- Antwort" wird hierin verwendet, um Verbesserungen bei allen Aspekten der CTL- Antwort zu umfassen, wie beispielsweise der Verbesserung der systemischen Verteilung, des Aktivitätswerts und der Langlebigkeit der Antwort auf CTL- induzierende Peptide. Die Zusammensetzung der vorliegenden Erfindung zur Verstärkung einer CTL-Antwort auf ein Immunogen wie ein Peptid beinhaltet die Zugabe einer Zusammensetzung, die eine getrennte und verschiedene Art von Peptiden beinhaltet, zu dem Immunisierungsgemisch, das eine T-Helferzellinduzierende Aktivität besitzt. Um die Verstärkung der CTL-Antwort auf diese Weise zu erzielen, würde man deshalb, zusätzlich zu dem Immunogen selbst, eine immunologisch wirksame Menge eines Peptids, das ein T-Helferzell-Epitop trägt, an ein Tier verabreichen.

Ein Verfahren zur Identifizierung einer Kandidatensubstanz, die eine CTL- Antwort verstärken kann, wird ebenfalls beschrieben. Um eine derartige verstärkende Substanz, wie z. B. ein Peptid, zu identifizieren, würde man einem Tier sowohl die Kandidatensubstanz als auch ein Immunogen, das eine CTL-Antwort induzieren kann, verabreichen. Die CTLs würden dann aus dem Tier wiedergewonnen und ihre Aktivität, einschließlich der systemischen Verteilung und der Langlebigkeit würden bestimmt werden. Eine Kandidatensubstanz, die eine CTL- Antwort verstärken kann, würde als eine Substanz identifiziert werden, die die CTL-Antwort erhöht, unter Verwendung beliebiger der vorgenannten Parameter, gegenüber dem, was in Gegenwart des Immunogens allein beobachtet wurde.

Die hierin beschriebenen Immunisierungsverfahren sind auf allgemeine Weise anwendbar, um CTL-Antworten gegen Immunogene aus einer beliebigen Quelle zu verstärken, einschließlich solcher aus einer großen Vielzahl von infektiösen Agentien wie Viren oder Parasiten. In bevorzugten Ausführungsformen wird die vorliegende Offenbarung jedoch beispielhaft dargestellt durch Verstärken der CTL-Antwort gegen Bestandteile der HIV-Virus-Familie. Es können CTL- Antworten gegen Epitope gebildet werden, die sich innerhalb der Produkte eines beliebigen viralen Gens befinden, wie z. B. die gag-, pol-, nef- und env-Gene, wobei die Produkte der env-Gene bevorzugte Zielmoleküle ("targets") sind.

Jedes beliebige einer großen Vielzahl von Peptidsequenzen kann gemäß der vorliegenden Erfindung als ein CTL-induzierendes Epitop eingesetzt werden. Diese umfassen die in TABELLE 1 aufgeführen Peptide, welche natürlich nur beispielhaft sind und nicht eine erschöpfende Liste darstellen. In bevorzugten Ausführungsformen ist es vorgesehen, daß Peptide aus dem env- (envelope) Genprodukt und insbesondere solche, die aus dem V3-Loop (Schleife) von HIV-gp120 stammen, als CTL-induzierende Peptide eingesetzt werden. Eine beispielhafte Liste von V3-Loop-Peptiden aus einer Vielzahl von HIV-1-Isolaten wird in TABELLE 2 dargestellt. Ein spezifisches Beispiel eines V3-Loop-abgeleiteten Peptids, von dem man festgestellt hat, daß es bei der Bildung von CTL-Antworten erfolgreich ist, ist das Peptid R15K, das die Sequenz RIQRGPGRAFVTIGK (seq id no: 1) besitzt.

Tabelle 1 ANTI-HIV-CTL-INDUZIERENDE EPITOPE-KANDIDATEN

*Cys-Thr-Glu-Met-Glu-Lys-Glu-Gly-Lys-Ile-Ser-Lys-Ile-Gly-Pro

TABELLE 2 SYNTHETISCHE PEPTIDE VOM V3-LOOP VERSCHIEDENER HIV-1-ISOLATE

Es stehen verschiedene Verfahren zur Verfügung zur Identifizierung von T- Helferzell-induzierenden Epitopen, die zur Anwendung hiermit geeignet sind. Beispielsweise ist es bekannt, daß die Amphipatizität einer Peptidsequenz seine Fähigkeit bewirkt, als ein T-Helferzell-induzierendes Agens zu wirken. In bevorzugten Ausführungsformen ist es vorgesehen, daß man wünschen würde, ein T- Helferzell-induzierendes Epitop einzusetzen, das einen amphipatischen Wert von etwa plus 10 bis etwa plus 20 besitzt. Andere quantifizierbare Charakteristika schließen z. B. den Besitz einer α-Helix-Windung von 100 ±15 Grad oder einer 3&sub1;&sub0;-Helix-Windung mit 120 ± 15 Grad ein. In Ausführungsformen, die sich insbesondere auf HIV beziehen, werden T-Helferzell-induzierende Peptide bevorzugt sein, die Sequenzen beinhalten, die von einer HIV-gp120-Sequenz stammen, die einen amphipatischen Wert innerhalb des oben genannten Bereiches besitzen.

Wiederum in Hinsicht auf HIV ist die Verwendung von Peptiden bevorzugt, die die Sequenz CRIKQIINMWQGVGKAMYA (C19A, seq id no: 2) enthalten, da festgestellt wurde, daß dieses Peptid besonders wirksam bei der Verstärkung von CTL-Antworten ist. Jedoch können Peptide, die andere T-Helferzell-induzierende Epitope einschließen, eingesetzt werden. Eine umfassende Diskussion von T- Helferzell-induzierenden Epitopen wird in US-Patent 5,128,319 wiedergegeben.

Verwandte Ausführungsformen dieser Erfindung betreffen Zusammensetzungen zum Bewirken von verbesserten CTL-Antworten. Derartige Zusammensetzungen werden im Allgemeinen mindestens 3 Peptide einschließen, wobei das erste ein CTL-induzierendes Epitop enthalten wird, gegen das die Immunantwort auf spezifische Weise gewünscht wird, wobei das zweite eine HIV-Infektions-inhibierende Peptidsequenz umfassen wird, die das Eintreten von HIV in eine Zielzelle inhibiert, und wobei das dritte ein T-Helferzell-induzierendes Epitop umfassen wird. Natürlicherweise würde eine Kombination einer derartigen Zusammensetzung, in der die Peptide in einem pharmakologisch verträglichen Vehikel dispergiert sind, eine ideale Formulierung zur Verwendung als eine Vakzine sein.

Die Identifizierung von synthetischen Peptiden, die menschliche Zellen vor einer HIV-1-Infektion schützen, wird ebenfalls hierin beschrieben. Derartige inhibitorische Peptide können eingesetzt werden, um die HIV-Infektion von Zellen zu inhibieren, beispielsweise zur Verwendung in Assay-Protokollen oder als therapeutische Agentien zur Verwendung in der Behandlung von AIDS.

Wie er hierin verwendet wird, bezieht sich der Begriff "HIV-Infektionsinhibierende Sequenz" auf eine Peptidsequenz, die das Eindringen des HIV-Virus in seine Zielzelle verhindert. Ein inhibitorisches Peptid als solches kann so gekennzeichnet werden, daß es eine Peptidsequenz einschließt, die an dem Infektionsprozeß beteiligt ist oder die dazu dient, die Zielzelle zu kontaktieren. Infektions-inhibierende Peptide schließen insbesondere Peptide ein, die eine Sequenz umfassen, wobei Antikörper gegen diese Sequenz in der Lage sind, eine zelluläre Infektion durch HIV zu inhibieren.

Die vorliegende Erfindung offenbart, daß synthetische Peptide mit Sequenzen, die von dem HIV-1-env-Genprodukt, gp120, stammen, die Fähigkeit besitzen, eine zelluläre Infektion durch HIV zu inhibieren. Insbesondere haben die Erfinder HIV-Infektions-inhibierende Sequenzen innerhalb des V3-Loops und an dem N- terminalen Regionen von gp120 identifiziert. Es wird ebenfalls in Erwägung gezogen, daß es sich herausstellen kann, daß sich HIV-Infektions-inhibierende Sequenzen innerhalb der CD4-bindenden Region befinden können.

In bevorzugten Ausführungsformen erwägen die Erfinder die Verwendung von HIV-Infektions-inhibierenden Peptiden mit Sequenzen, die aus dem gp120-V3- Loop stammen. Wie hierin detailliert beschrieben, schließen Peptide, von denen man festgestellt hat, daß sie in dieser Hinsicht von Nutzen sind, beispielsweise jene Peptide von Tabelle 11 ein und insbesondere Peptide D23, D24, D25, D26, D30, D35, D38, D39, D40 und D44 (R15K), deren Sequenzen in TABELLE 11A gezeigt werden. Diese Peptide besitzen Sequenzen, die von den V3-Loops einer Vielzahl von Stämmen wie mn, rf, wmj-3, sc, z6, eli, mn (y-1) und mn (y-p) stammen. Es wird in Erwägung gezogen, daß bevorzugte von V3 stammende Infektions-inhibierende Peptide, die die in TABELLE 11A aufgeführten einschließen, und solche wie R15K, daß die Sequenz RIQRGPGRAFVTIGK (seq id no: 1) besitzt, und ebenfalls N24G, das die Sequenz NNTRKSIRIQRGPGRAFVTIGKIG (seq id no: 3) besitzt.

Ein wichtiger Aspekt der vorliegenden Erfindung ist die Entdeckung, daß Peptide mit Sequenzen, die Sequenzen einer Vielzahl von HIV-Isolaten entsprechen, die Fähigkeit besitzen, die HIV-Infektion von Zellen zu inhibieren. Zusätzlich zu den in TABELLE 11A gezeigten schließen diese Peptide beispielsweise H13N (HIGPGRAFYTTKN, seq id no: 7) ein, ein V3-Loop-Peptid aus dem HIV-1mn- Stamm, und T13Q (TKGPGRVIYATGQ, seq id no: 6), ein V3-Loop-Peptid aus dem HIV-1-rf-Stamm. Es ist jedoch in Hinsicht auf TABELLE 11 wichtig festzustellen, daß diese Daten aus Assays zusammengestellt wurden, die spezifisch darauf gerichtet waren, eine Infektion durch einen HIV-Stamm, nämlich HIV-1 IIIB zu inhibieren. Deshalb können Peptide wie D27, D28, D29, D31, D32, D33, D34 und D37, die in TABELLE 11 B aufgeführt sind, die keine Aktivität in einem spezifischen inhibitorischen Assay zeigen, dennoch einem Nutzen bei der Vorbeugung der Infektion von Zielzellen durch eine Vielzahl anderer HIV-Stämme besitzen, beispielsweise gegen die HIV-Stämme ny-5, rf, cdc4, z3, sf2 mal, z321 und jy-1.

Die Erfinder haben ebenfalls Peptide aus dem N-Terminus von gp120, wie E13V, das die Sequenz EQLWVTVYYGVPV (seq id no: 4) besitzt, als Infektionsinhibierende Peptide identifiziert. Dies ist eine wichtige Feststellung, da dieser Bereich von gp120 bekanntermaßen zwischen verschiedenen HIV-Stämmen relativ konserviert ist.

Es sollte auch beachtet werden, daß kleinere Peptide, die Anteile dieser Sequenzen einschließen, wie beispielsweise RBK, daß die Sequenz RAFVTIGK (seq id no: 5) besitzt, ebenfalls als Infektions-inhibierende Sequenzen besitzend identifiziert worden sind. Kleinere Peptide und Peptidfragmente als solche werden in Übereinstimmung hiermit als nützlich und als innerhalb des Bereiches dieser Erfindung befindlich betrachtet.

Die Infektions-inhibierenden Peptide der vorliegenden Erfindung können natürlich vorkommende oder gentechnisch erzeugte Sequenzvariationen einschließen und dennoch noch die Funktion ausüben, das Eindringen von HIV in Zellen zu verhindern. Es wird in Betracht gezogen, daß die biologisch funktionellen Äquivalente der Peptide in den TABELLEN 1, 2 und 11 als solche und Peptide wie R15K, N24G, E13V, H13N und T13Q ebenfalls in den Bereich der vorliegenden Erfindung fallen.

Derartige biologisch funktionelle Peptidäquivalente können Veränderungen einschließen, die auf dem hydropathischen Index von Aminosäuren beruhen. Man glaubt, daß der relative hydropathische Charakter der Aminosäure die Sekundärstruktur des resultierenden Proteins oder Peptids bestimmt, welche wiederum seine Interaktion mit anderen Molekülen, wie z. B. Rezeptoren, Antikörpern und dergleichen, definiert. Es ist allgemein bekannt, daß bestimmte Aminosäuren andere Aminosäuren ersetzen können, die einen ähnlichen hydropathischen Index oder Wert besitzen und dennoch zu einem Peptid mit ähnlicher biologischer Eigenschaft führen (Kyte & Doolittle, 1982).

Die hydropathischen Indices der Aminosäuren sind: Isoleucin (+4,5); Valin (+4,2); Leucin (+3,8); Phenylalanin (+2,8); Cystein/Cystin (+2,5); Methionin (+1,9); Alanin (+1,8); Glycin (-0,4); Threonin (-0,7); Serin (-0,8); Tryptophan (-0,9); Tyrosin (-1,3); Prolin (-1,6); Histidin (-3,2); Glutamat (-3,5); Glutamin (-3,5); Aspartat (- 3,5); Asparagin (-3,5); Lysin (-3,9); und Arginin (-4,5). Als biologisch funktionelle Äquivalente werden jene Peptide betrachtet, die die Substitution von Aminosäuren einschließen, deren hydropathische Indices innerhalb von ±2 liegen, und vorzugsweise innerhalb von ±1 liegen, und besonders bevorzugt innerhalb von ±0,5.

Eine Substitution von ähnlichen Aminosäuren kann auch auf der Grundlage der Hydrophilie vorgenommen werden, insbesondere wo beabsichtigt ist, daß biologisch funktionelle äquivalente Protein oder Peptid, das dadurch gebildet wird, in immunologischen Ausführungsformen zu verwenden, wie dies für die vorliegende Erfindung der Fall ist. US-Patent 4,554,101 stellt fest, daß die größte lokale durchschnittliche Hydrophilie eines Proteins, wie durch die Hydrophilie seiner benachbarten Aminosäuren bestimmt ist, mit seiner Immunogenität und Antigenität, d. h. mit einer biologischen Eigenschaft des Proteins, korreliert.

Wie in US-Patent 4,554,101 ausführlich dargelegt, sind die folgenden Hydrophiliewerte den Aminosäureresten zugeordnet worden: Arginin (+3,0); Lysin (+3,0); Aspartat (+3,0 ± 1); Glutamat (+3,0 ± 1); Serin (+0,3); Asparagin (+0,2); Glutamin (+0,2); Glycin (0); Prolin (-0,5 ± 1); Threonin (-0,4); Alanin (-0,5); Histidin (- 0,5); Cystein (-1,0); Methionin (-1,3); Valin (-1,5); Leucin (-1,8); Isoleucin (-1,8); Tyrosin (-2,3); Phenylalanin (-2,5); Tryptophan (-3,4). Auf ähnliche Weise werden jene Peptide als biologisch funktionelle Äquivalente betrachtet, die die Substitution von Aminosäuren einschließen, deren Hydrophiliewerte innerhalb von ±2, vorzugsweise innerhalb von ±1, und stärker bevorzugt innerhalb von ±0,5 liegen.

Wie vorstehend umrissen, basieren Aminosäuresubstitutionen deshalb im allgemeinen auf der relativen Ähnlichkeit der Aminosäureseitenkettensubstituenten, zum Beispiel deren Hydrophobie, Hydrophilie, Ladung, Größe und dergleichen. Beispielhafte Substitutionen, die verschiedenartige der vorgenannten Charakteristika berücksichtigen, sind dem Fachmann wohl bekannt und umfassen: Arginin und Lysin; Glutamat und Aspartat; Serin und Threonin; Glutamin und Asparagin; und Valin, Leucin und Isoleucin.

Zusätzlich zu den vorstehend beschriebenen spezifischen Sequenzen und deren biologisch funktionellen Äquivalenten können andere Sequenzen als HIV- Infektions-inhibierende Peptide eingesetzt werden. Wie vorstehend erwähnt, wird es beispielsweise in Erwägung gezogen, daß jede beliebige Sequenz, bei der Anti- Peptid-Antikörper gegen diese Sequenz gezeigtermaßen das Eindringen des Virus in Zellen inhibieren, ein geeignetes HIV-Infektions-inhibierendes Peptid zur Verwendung in Übereinstimmung hiermit sein wird. Die Vorteile der vorliegenden Erfindung schließen den Nachweis ein, daß derartige Peptide auf wirksame Weise bei niedrigen Konzentrationen, wie von zwischen ungefähr 1 ug/ml bis ungefähr 1 ng/ml, wirken können.

Auf jeden Fall können angesichts der vorliegenden Offenbarung nun Kandidatensequenzen mit dem Potenzial als HIV-Infektions-inhibierende Peptide zu wirken, identifiziert und getestet werden. Derartige Kandidatenpeptide werden wahrscheinlich Sequenzen einschließen, die innerhalb des gp120-V3-Loops oder der N-terminalen Region befindlich sind oder sogar innerhalb der CD4-bindenden Region von gp 120, und vorzugsweise werden sie Sequenzen sein, gegen die Antikörper hervorgerufen wurden und von denen gezeigt worden ist, daß sie eine zelluläre Infektion durch HIV inhibieren oder reduzieren. Kandidatensequenzen können als Peptide synthetisiert und auf ihre Fähigkeit, eine zelluläre Infektion durch HIV zu inhibieren, getestet werden.

Wie vorstehend diskutiert, können in den erfindungsgemäßen Zusammensetzungen ein Peptid bzw. Peptide, die ein oder mehrere CTL-induzierende Epitope plus eine HIV-inhibierende Sequenz bzw. Sequenzen enthalten, mit einem Peptid bzw. Peptiden kombiniert werden, die ein oder mehrere T-Helferzell-induzierende Epitope einschließen, um eine Immunisierung oder Vakzinierung oder Formulierungen zu erzeugen. In Hinsicht auf Peptidcocktails für eine Immunisierung wird die Verwendung von Peptiden mit Sequenzen, die den stärker konservierten Bereichen von HIV-gp120 entsprechen, im allgemeinen bevorzugt sein. Zusätzlich und mit spezifischem Bezug auf HIV kann ein CTL-induzierendes Peptid oder CTL-induzierende Peptide mit einer HIV-Infektions-inhibierenden Sequenz bzw. HIV-Infektions-inhibierenden Sequenzen kombiniert werden als therapeutische Formulierungen.

Jedoch, und dies ist wichtig, werden durch die vorliegende Erfindung auch Zusammensetzungen vorgesehen, die alle drei der unterschiedlichen Klassen von hierin identifizierten Peptiden umfassen. Eine derartige einzelne Formulierung würde in der Lage sein, eine Infektion von menschlichen Zellen durch HIV-1 zu verhindern und HIV-1-spezifische CTL-Antworten zu induzieren. Da alle diese Formulierungen vollständig synthetisch und definiert sind, werden diese Reagenzien sowohl ökonomisch als auch sicher sein.

Natürlich kann jedes beliebige der Peptide mehr als eine immunologische Aktivität besitzen. Ein Beispiel für dieses Phänomen ist das Peptid R15K, das CTL- induzierende und Infektions-inhibierende Eigenschaften besitzt. Bei den meisten bevorzugten Ausführungsformen wird in Erwägung gezogen, daß Peptide eingesetzt werden, die nicht eine signifikante Erzeugung von Antikörpern induzieren, die natives HIV binden. Zusätzlich dazu, daß sie direkt als Monomere verwendet werden, können die erfindungsgemäßen Peptide auch als Polymere oder mit Lipid- Schwänzen versehene Peptide formuliert werden.

Verfahren zur Durchführung eines Assays für eine Zusammensetzung auf seine Eigenschaft, eine zytotoxische T-Zell (CTL)-Antwort in einem Tier zu induzieren, werden ebenfalls hierin beschrieben. Damit verwandt sind Verfahren zum Durchführen eines Assays für eine Zusammensetzung auf seine Fähigkeit, eine CTL- Antwort durch einen davon verschiedenen Bestandteil zu induzieren. Diese Verfahren zum Durchmustern (Screenen) umfassen im allgemeinen das Immunisieren eines Tiers, wie eines Menschen oder eines Versuchstiers wie einer Maus, Ratte, Kaninchen, Meerschweinchen, Ziege, Rhesusaffen oder Schimpansen, danach das Sammeln von Zellen aus den Lymphknoten oder anderen lymphoiden Geweben des Tiers, und dann das Testen des Gewebes auf die Gegenwart von CTLs, die geprimt sind, Zellen zu töten oder zu lysieren, die einen Bestandteil eines infektiösen Agens, wie ein Virushüll-, ein Kern-Protein, eines der funktionellen Proteine (z. B. Reverse Transkriptase) oder dergleichen, erzeugen.

Somit umfaßt dieses Verfahren im allgemeinen drei Schritte, wobei der erste Schritt das Immunisieren eines Tiers mit der zu testenden Zusammensetzung beinhaltet. Während man glaubt, daß jede akzeptierte Weise und Route der Immunisierung eingesetzt werden kann und nichtsdestrotrotz einige Vorteile in Übereinstimmung hiermit erzielt werden können, haben die Erfinder festgestellt, daß besondere Vorteile mit der intradermalen Immunisierung verknüpft sind. Es wird geglaubt, daß eine intradermale Immunisierung bevorzugt ist, da sie dazu dient, den Zell-vermittelten Zweig des Immunsystems auf wirksamere Weise zu aktivieren. Darüber hinaus haben die Erfinder festgestellt, daß - obwohl man, wo es gewünscht ist, mehrfache Injektionen der immunisierenden Substanz wählen kann, und sogar mehrere Injektionsstellen - ein besonderer Vorteil der Erfindung ist, daß eine einzelne Injektion des Kandidaten normalerweise ausreichend sein wird, um eine nachweisbare CTL-Aktivierung in einem nahegelegenen Lymphknoten zu erzielen. Weiterhin haben die Erfinder festgestellt, daß - obwohl man, wo es gewünscht ist, Immunisierungsmodifikatoren einsetzen kann, wie T-Helferzell- Peptidsequenzen, Lipidstrukturen, die eine Mizellenbildung induzieren, Peptid- Polymerisationsverfahren oder dergleichen in Verbindung mit der Kandidatenzusammensetzung - die Sensitivität des Assays derart ist, daß die Verwendung derartiger Modifikatoren im allgemeinen nicht erforderlich ist, um ein CTL-Primen zu erzielen.

Sobald eine Immunisierung bewirkt worden ist, wird es dann notwendig sein, zytotoxische T-Zellen aus dem lymphoiden Gewebe des immunisierten Tieres zurückzugewinnen. Das bevorzugte lymphoide Gewebe wird ein Lymphknotengewebe sein, und am stärksten bevorzugt ein Gewebe aus einem einer Drainage unterzogenen Lymphknoten proximal der Injektionsstelle. Wie er hierin verwendet wird, ist beabsichtigt, daß der Ausdruck "proximaler Knoten" sich auf einen Knoten oder mehrere Knoten bezieht, die sich proximal zur Injektionsstelle befinden, zum Beispiel der popliteale Knoten der Maus im Anschluß an eine Injektion des Fußballens. Man glaubt, daß die Verwendung von proximalem oder drainieren dem/ableitendem Knotengewebe zum Identifizieren einer CTL-Aktivierung ein Grund für die Schnelligkeit der stärker bevorzugten Aspekte der vorliegenden Offenbarung ist. Derartige Knoten liegen physisch in der Nähe der Immunisierungsstelle oder in dem Bereich, der die Immunisierungsstelle drainiert, und ebenfalls eingeschlossen sind solche drainierenden Knoten, die sich physisch in einem größeren Abstand von der Immunisierungsstelle befinden.

Der abschließende Schritt des Assays in seinem allgemeinsten Sinne beinhaltet das Bestimmen, ob die zytotoxischen T-Zellen durch die Zusammensetzung aktiviert worden sind. Obwohl es im allgemeinen nicht erforderlich ist, wird es typischerweise bevorzugt sein, das Maß der Aktivierung tatsächlich durch z. B. radioaktive Chrom-Freisetzungs-Assays oder andere Radioisotopen-Assays oder Einzelzell-Assays zu messen; Einzelzell-zytotoxische Assays unter Verwendung von Vitalfarbstoffen und/oder Cell-Sortern könnten ebenfalls eingesetzt werden.

Wo die Messung der Aktivierung der zytotoxischen T-Zellen gewünscht ist, beinhaltet ein bevorzugtes Verfahren das Kontaktieren einer tötungswirksamen (killing effective) Menge der zytotoxischen T-Zellen mit Zielzellen mit passendem MHC (MHC-matched target cells), die das Kandidatenepitop auf ihren Zelloberflächen auf weisen; Aufrechterhalten dieses Kontaktes für eine Zeitdauer, die für die zytotoxischen T-Zellen ausreicht, die Zielzellen zu lysieren; und Bestimmen des Grades an T-Zell-vermittelter Lyse der Zielzellen. Jedoch kann jedes beliebige Verfahren, das eine spezifische CTL-Antwort nachweisen kann, eingesetzt werden, einschließlich, aber nicht hierauf beschränkt, von Chrom-Freisetzungs-Assays, Einzelzell-Assays oder sogar der Bestimmung von Zell-Zell-Konjugaten.

Ein Vorteil der vorliegenden Technik ist die Geschwindigkeit, mit der man in der Lage ist, die Fähigkeit der Kandidatensubstanz zu bestimmen, CTLs zu aktivieren. Zuvor bekannte Techniken haben im allgemeinen eine Wartezeit von einigen Wochen erfordert (Kast et al., 1991; Aichele et al., 1990). Die vorliegende Technik jedoch erfordert typischerweise nur ungefähr 7 bis 10 Tage im Anschluß an eine Immunisierung. Man glaubt, daß der Grund für die herabgesetzte Zeitdauer, die zur Erzielung einer CTL-Antwort mit dem erfindungsgemäßen Assay erforderlich ist, das Ergebnis der Route der Immunisierung und der Verwendung von drainlerenden oder proximalen Lymphknotenzellen ist. Ein weiterer Vorteil ist die Fähigkeit, Peptidkandidaten zu testen, ohne die Verwendung eines assoziierten Modifikators wie Trägermolekülen, Lipid-Schwänzen oder T-Helferzell-Epitopen, um seine CTL-Aktivität zu verstärken.

Typischerweise wird die auf eine CTL-primende Fähigkeit zu testende Zusammensetzung ein oder mehrere Peptide oder Peptid-Multimere umfassen, von denen man glaubt oder vermutet, daß sie nützliche Aktivitäten besitzen. Durch die Anwendung der Verfahren der vorliegenden Offenbarung auf solche Peptide wird man somit in die Lage gesetzt zu bestimmen, ob derartige Peptide tatsächlich eine CTL-primende Aktivität besitzen. Wenn dies der Fall ist, dann wird das Peptid ein Kandidat für die Aufnahme in eine CTL-primende Vakzine sein. Der Fachmann wird erkennen, daß während Kandidaten für eine CTL-primende Aktivität im allgemeinen Peptide (oder Proteine) umfassen, die Anwendung des erfindungsgemäßen Assays im Kontext von Nicht-Peptidyl-Verbindungen sicherlich nicht ausgeschlossen ist.

Es wird vorgeschlagen, daß das Verfahren einen breiten Anwendungsbereich finden wird, insbesondere bei der Identifizierung von Bestandteilen zur Verwendung bei der Herstellung von Vakzinen für die Behandlung und/oder Prävention von AIDS. Deshalb wird die vorliegende Offenbarung im Fall von Ausführungsformen, die auf die Identifizierung von Epitopen zum Fördern einer spezifischen Anti-HIV-CTL-Antwort gerichtet sind, im allgemeinen die Identifizierung von Peptiden betreffen, die die Fähigkeit besitzen, eine CTL-Antwort gegen HIV-infizierte Zellen zu richten.

Im Kontext der Entwicklung einer Vakzine wird das Verfahren zunächst das Identifizieren einer CTL-reaktiven Zusammensetzung in Übereinstimmung mit dem vorgenannten Verfahren umfassen, und dann das Zumischen der Zusammensetzung mit einem oder mehreren pharmazeutisch verträglichen Verdünnungsmitteln oder Zusätzen wie Wasser, Salzen, Emulgatoren und/oder Adjuvanzien. Die Menge der Zusammensetzung, die der Vakzine zugesetzt wird, wird natürlich in Abhängigkeit von seiner Fähigkeit variieren, eine spezifische CTL-Antwort zu induzieren, seiner Löslichkeit und anderen biologischen Antworten. Die Auswahl einer geeigneten Menge der identifizierten CTL-primenden Zusammensetzung wird deshalb angesichts der vorliegenden Offenbarung innerhalb der technischen Fähigkeiten des Standes der Technik sein.

In den anderen Ausführungsformen beinhaltet die Erfindung ein Verfahren zur Herstellung von zytotoxischen T-Zellen. In seinem allgemeinsten Sinne umfaßt dieses Verfahren das Immunisieren, vorzugsweise auf intradermale Art, eines Tieres mit einer Zusammensetzung, die die Fähigkeit besitzt, eine zytotoxische T- Zell-Antwort gegen ein zuvor ausgewähltes Epitop auf einem als Ziel gewählten Protein zu induzieren. Das Epitop oder die Epitope, die eingesetzt werden, können für ein CTL-Primen spezifisch sein oder nicht, und körnen somit im wesentlichen Antikörper induzieren oder nicht, die mit dem als Ziel ausgewählten Protein kreuzreagieren. Jedoch wird es bei der Ausübung dieses Aspekts der Erfindung typischerweise gewünscht sein, zytotoxische T-Zellen aus Lymphknoten des Tieres für eine weitere Verwendung wiederzugewinnen. Man stellt sich zahlreiche potentielle Verwendungen von spezifisch geprimten CTLs vor. Beispielsweise wird im Falle von einer Therapie des Menschen in Erwägung gezogen, daß auf spezifische Weise geprimte CTLs kultiviert und an Menschen zur Behandlung einer HIV-Infektion verabreicht werden können. In diesem Falle werden die CTLs durch Immunisieren der Spezies in vivo und Isolieren der Immunzellen zum Expandieren in vitro in Gegenwart eines geeigneten Peptids, Cytokinen und präsentierenden Zellen hergestellt.

Typischerweise wird die Erfindung für die Induktion einer HIV-gerichteten CTL- Antwort die Verwendung von Peptiden beinhalten, die von 7 bis ungefähr 30 Aminosäurereste umfassen, und eine Sequenz besitzen, die einer Domäne eines HIV-Proteins entspricht, wie dem gp160-Hüll- und Kern-Proteinen, der Reversen Transkriptase, tat-, rev- oder anderen von dem Virus exprimierten Genprodukten, wobei das Peptid innerhalb seiner Struktur eine konservierte Region beinhaltet.

Zur Herstellung von Vakzinen sind Peptidmultimere im allgemeinen bevorzugt, um mehrere CTL-Epitope innerhalb eines einzelnen Komplexes einzuschließen. Zwei spezifische Klassen von Peptidmultimeren sind offenbart. Bei einer Klasse ist der Amino-terminale Rest eines Peptids in einer Peptidbindung an ein Spacer- Peptid, das einen Amino-terminalen Lysyl-Rest und einen bis ungefähr fünf Aminosäurereste enthält, wie Glycyl-Reste, um ein zusammengesetztes Polypeptid bzw. Verbundpolypeptid (composite polypeptide) zu bilden. Jene zugefügten Reste des Spacer-Peptids interferieren weder mit der immunisierenden Fähigkeit des Multimers, noch mit seiner Fähigkeit zur Bildung von oberflächenaktiven Mittelartigen Mizellen in wäßrigen Zusammensetzungen. Die Alpha- und Epsilon- Aminogruppen des Amino-terminalen Lysylrests werden mit einer C&sub1;&sub2;-C&sub1;&sub8;- Fettsäure wie Palmitinsäure unter Bildung des Reaktionsproduktes, das verwendet wird, amidiert. Das so gebildete Diamid bildet oberflächenaktives Mittel-artige Mizellen-artige Multimere in einer wäßrigen Zusammensetzung.

Eine zweite Klasse von Multimeren ist ein Polymer mit einem Peptid als Grundeinheit. Hierbei wird jedes Peptid synthetisiert, um einen Cystein (Cys)-Rest an jedem seiner Amino- und Carboxy-Termini zu enthalten. Das resultierende Di- Cystein-terminierte (di-Cys)-Peptid wird dann unter Polymerisation der di-Cys- Peptidmonomere in ein Polymer oder ein zyklisches Peptidmultimer oxidiert, in welchem die Peptidgrundeinheiten durch Cystin (oxidiertes Cystein)-Reste verbunden sind.

Ein Peptidmultimer jeder dieser Klassen kann ein oder eine Vielzahl von verschiedenen Peptidsequenzen enthalten. Ein Peptid eines Multimers ist ein "aktives" Peptid, in dem Sinne, daß wenn es in einer Zusammensetzung verwendet wird, wie nachfolgend diskutiert, das Multimer eine Zell-vermittelte Immunität wie die Erzeugung von zytotoxischen T-Zellen induzieren kann. Ein Multimer kann ebenfalls ein inaktives Peptid enthalten, zum Beispiel um beim Dispergieren des Multimers in dem wäßrigen Medium zu helfen. Der Lysyl-enthaltende Peptid- Spacer, der vorangehend diskutiert wurde, kann als ein derartiges inaktives Peptid gesehen werden.

Das Peptidmultimer wird in einer wäßrigen Zusammensetzung (inoculum) eingesetzt. Diese Zusammensetzung enthält Wasser mit einem darin dispergierten zuvor beschriebenen Multimer. Die Zusammensetzung, wenn sie zur Immunisierung eines immunkompetenten Wirtstiers wie einer Maus verwendet wird, besitzt die Fähigkeit des Induzierens einer Zell-vermittelten Immunität wie einer Aktivierung von zytotoxischen T-Zellen gegen das native HIV-Protein, entsprechend in Sequenz der eines aktiven Peptids des Multimers, aber es induziert im wesentlichen nicht die Erzeugung von Antikörpern, die mit dem entsprechenden nativen HIV- Protein immunreagieren. Die Zusammensetzung enthält somit eine immunisierende wirksame Menge eines zuvor diskutierten multimeren Peptids.

KURZE BESCHREIBUNG DER ZEICHNUNGEN

Fig. 1. Die in vitro-Proliferation von poplitealen Lymphknoten-Zellen (PLN)- Zellen (popliteal lymph node cells) nach in vivo-Immunisierung von BALB/c- Mäusen. BALB/c-Mäuse wurden mit einer wäßrigen Zusammensetzung immunisiert, die eine immunologisch wirksame Menge eines erfindungsgemäßen Peptidmultimer-Polymers, das von jedem der Peptide 61, 63, 65 und 67 hergestellt worden war, enthielt. Tuberculin-gereinigte Proteinderivate (PPD) wurden wie gezeigt als eine Kontrolle verwendet. Ein ³H-Thymidin (³H-TdR)-Einbau-Assay wurde für diese Studien angewendet. Die Daten werden durch einen Stimulationsindex veranschaulicht, der als der mehrfache Anstieg der Zählimpulse in Gegenwart des Peptid-Antigens im Vergleich zu den Hintergrundwerten, wenn kein Antigen zu gegeben wurde, berechnet wurde. Einzelheiten dieser Studie werden nachfolgend diskutiert.

Fig. 2. T-Zell-Proliferation (³H-TdR-Einbau) von PLN-Zellen nach einer Immunisierung von B6C3-F1-Mäusen mit einer wäßrigen Zusammensetzung, die eine immunologisch wirksame Menge eines erfindungsgemäßen Peptidmultimer- Polymers enthielt, das aus jedem der Peptide 61, 63, 65 und 67 hergestellt wurde. Ein damit nicht verwandtes Peptid, PPD und gp160, wurde als Kontrolle eingesetzt. Die Daten werden als der ³H-TdR-Einbau [delta (Δ)-Zählimpulse pro Minute (cpm)] dargestellt, erhalten durch Subtrahieren der Radioaktivitätswerte in Kontrollvertiefungen ohne zugesetztes Antigen von solchen in Vertiefungen mit Antigen. Einzelheiten dieser Studie und der Studie von Fig. 3-5 werden nachfolgend diskutiert.

Fig. 3. Wie in Fig. 2 gezeigt, mit der Ausnahme, daß A. SWxBALB/c-F1- Mäuse als die Wirtstiere eingesetzt wurden.

Fig. 4. Wie in Fig. 2, aber unter Verwendung von Multimeren, die von Peptiden 103 bis 117 (a bis o, respektive) hergestellt wurden, um B6C3-F1-Mäuse zu immunisieren.

Fig. 5. Wie in Fig. 4 gezeigt, mit der Ausnahme, daß A. SWxBALB/c- Mäuse wiederum als die Wirtstiere eingesetzt wurden.

Fig. 6. B6C3-F1-Maus-PLN-Zell-Proliferation durch ³H-TdR-Einbau unter Verwendung variierender Konzentrationen an Peptidmultimer und gp120 als Antigene. Tafel A: Ein Peptidmultimer-Polymer, das von Peptiden 10 hergestellt wurde; Tafel B: Ein Multimer, das von Peptid 106 hergestellt wurde. PPD und nichtverwandte Peptide wurden als Kontrollen eingesetzt. Eine weitere Diskussion in bezug auf Fig. 6-8 ist im folgenden Text zu finden.

Fig. 7. PLN-Zell-Proliferation von B6C3-F1-Mäusen unter Verwendung variierender Konzentrationen von gp 160 und Peptidmultimer-Polymeren, die von Peptiden 61 (Tafel A) und 63 (Tafel B) als Antigene hergestellt worden waren, mit PPD und einem nichtverwandten Peptid als Kontrollen.

Fig. 8. PLN-Zell-Proliferation von B6C3-F1-Mäusen unter Verwendung variierender Konzentrationen von gp 120 und Peptidmultimer-Polymeren, die von Peptiden 65 (Tafel A) und 111 (Tafel B) als Antigene hergestellt wurden, mit PPD und einem nichtverwandten Peptid als Kontrollen.

Fig. 9. CTL-Aktivität von poplitealen Lymphknoten (PLN)-Zellen von BALB/c-Mäusen nach einer Immunisierung mit HIV-env-V3-Loop-R15K-Peptid (As. 315-329) in drei Formen. A, lineares Monomer; B, Disulfid-verknüpftes Polymer, gebildet durch Cysteinreste, die sowohl an N- und C-Terminus zugefügt wurden; C, mit Lipidschwänzen versehene Mizellen, gebildet durch Konjugation an Dipalmitoyl-Lysin-Glycin-Glycin an dem N-Terminus (Hoff, 1984; Sastry et al., 1991). BALB/c-Mäuse (mit einem Alter von 6-8 Wochen) wurden mit Peptid (100 ug in einer 1 : 1-Emulsion mit CFA) in dem hinteren Fußkissen immunisiert. Nach 10 Tagen wurden Zellen, die aus den PLN erhalten worden waren, in vitro für 5 Tage mit bestrahlten (3300 Rad) syngenischen Maus-Milzzellen restimuliert, die mit der monomeren Form des Peptids (40 ug/ml) für 2 h bei 37ºC vorbehandelt worden waren. Die Zellgemische wurden in 5-10 ml von Click-Medium (dick et al., 1972) gehalten, das mit 10% fötalem Kalbserum (FCS) und 50 uM 2-Mercaptoethanol ergänzt war, dann dreimal mit RPMI 1640-Medium, 10% FCS gewaschen. Die CTL-Aktivität wurde durch einen &sup5;¹Cr-Freisetzungsassay (Platsoucas & Good, 1981) bestimmt gegen syngenische Zielzellen (P815) mit oder ohne Vorbehandlung mit der monomeren Form des Peptids für 2 h bei 37ºC.

Fig. 10. CTLs von BALB/c-Mäusen, die in vivo mit beliebigen R15K-artigen Peptiden immunisiert wurden, erkennen Zielzellen mit passendem MHC, die entweder mit Peptidmonomeren (P815+Peptid) vorbehandelt worden waren oder mit rekombinantem Vakziniavirus infiziert worden waren, der das HIV-IIIB- Hüllprotein, gp160 (P815+VPE16) exprimierte. Die Immunisierung von Mäusen und die Peptid-Vorbehandlung von P815-Zielzellen wurde wie in Fig. 9 durchgeführt. Es wurden 5 · 10&sup6; P815-Zielzellen mit 5 · 10&sup7;-Plaque-bildenden Einheiten einer Kontrolle (VSC8) oder von rekombinantem Vakzinia, der das HIV-Hüllprotein (VPE16) exprimierterte, für 18-20 Stunden vor einem Markieren mit 100 uCi &sup5;¹Cr (ICN Radiochemicals, Irvine, CA) infiziert. Die cytotoxische Aktivität wurde durch einen &sup5;¹Cr-Freisetzungsassay (Platsoucas & Good, 1981) bestimmt.

Fig. 11. CTLs, geprimt durch in vivo-Immunisierung mit entweder der monomeren Form oder der mit einem Lipid-Schwanz versehenen Mizellenform des HIV-V3-Loop-R15K-Peptids, sind CD8-positiv. Restimulierte PLN-Zellen (wie in Fig. 9) wurden mit Complement allein (+C) oder mit entweder einem monoklonalen Anti-CD4-Antikörper (Klon GK-1.5) plus C (+ Anti-CD4-C) oder mit einem monoklonalen Anti-CD8-Antikörper (Klon 53-6.72) plus C (+ Anti- CD8+C), wie in Platsoucas & Good, (1981) behandelt. Die resultierenden Zellen wurden dann auf ihre Fähigkeit getestet, Zielzellen mit passendem MHC zu lysieren, die entweder mit der monomeren Form des Peptids (P815+Peptid) vorbehandelt worden waren oder mit rekombinantem Vakziniavirus infiziert waren, das das HIV-IIIB-Hüllprotein gp160 (P815+VPE16) exprimierte.

Fig. 12. CTL-Aktivität von Milzzellen von Mäusen, die mit R15K/R15K+Th immunisiert waren. 6-8 Wochen alte BALB/c-Mäuse wurden in das hintere Fußkissen mit 100 ug des R15K-Peptids allein oder mit 100 ug eines T-Helferzell- Peptids (Th), emulgiert in CFA, immunisiert. 2, 3 oder 4 Wochen nach der Immunisierung wurden sowohl PLN als auch Milzzellen der Mäuse gesammelt und für 5 Tage mit bestrahlten, syngenischen Milzzellen der Maus restimuliert, die mit R15K für 2 Stunden vorbehandelt worden waren. Es wurde ein üblicher 4- stündiger &sup5;¹Cr-Freisetzungsassay durchgeführt, wie durch Sastry et al. (1992) beschrieben. Es sind repräsentative Daten von PLN (A) und Milzzellen (B) gezeigt, und diese zeigen, daß ein T-Helferzell-Peptid von dem HIV-env-Protein die systemische CTL-Antwort auf das R15K-V3-Loop-Peptid (seq id no: 1) verstärkt.

Fig. 13. Peptid R15K inhibiert eine Infektion von menschlichen T-Zellen (MT- 4) durch HIV-1. MT-4-Zellen sind menschliche T-Zellen, die durch den menschlichen T-Zell-Leukämievirus Typ 1 chronisch infiziert sind und eine lytische Infektion mit HIV-1 durchmachen (Larder et al., 1989). Deshalb wird eine Inhibierung der HIV-1-Infektion von MT-4-Zellen einen Zelltod verhindern. In diesem Experimenten wurden MT-4-Zellen (5 · 10&sup4;/100 ul) in Dreifach-Zellkulturvertiefungen (triplicate wells) von Mikrotiterplatten mit 96 Vertiefungen mit verschiedenen Konzentrationen des R15K-Peptids für 15 Minuten bei 37ºC vorinkubiert und mit HIV-1 herausgefordert. Kontrollen schlossen Zellen allein und Zellen ein, die mit HIV-1 infiziert worden waren, aber ohne zugesetztes Peptid. Sieben Tage nach der Infektion wurde die Gesamtzahl der lebensfähigen Zellen unter Verwendung des MTT-Farbstoffverringerungsassays von Larder et al. (1989) bestimmt. Die Linie mit der Bezeichnung "kein Virus" zeigt eine Wirkung von verschiedenen Konzentrationen von Peptid auf das Überleben von MT-4-Zellen in Abwesenheit einer HIV-1-Infektion an. Die Linie mit der Bezeichnung "+Virus" zeigt einen Schutzeffekt von Peptid R15K (seq id no: 1).

Fig. 14. Peptid R15K inhibiert eine HIV-1-Infektion von MT-4-Zellen, wie durch einen Reverse Transkriptase-Assay gemessen wurde. In diesen Experimenten wurden MT-4-Zellen wie in Fig. 13 infiziert, aber anstatt des Messens des zytopathischen Effektes wurde die Menge an Reverse Transkriptase (RT)- Aktivität in dem Kulturmedium sieben Tage nach der Infektion durch das Verfahren von Popovic et al. (1984) bestimmt.

Fig. 15. Peptid R15K inhibiert eine HIV-1-Infektion der menschlichen T- Zelllinie CEM und H9. Die CEM- und H9-Zellen (1 · 10&sup5; Zellen/Vertiefungen) in getrennten Experimenten wurden in Dreifach-Vertiefungen einer Platte mit 48 Vertiefungen in Gegenwart oder Abwesenheit verschiedener Konzentrationen von Peptid R15K mit HIV-1 infiziert. Das experimentelle Protokoll war wie in Fig. 13 beschrieben. Sieben Tage nach der Infektion wurde die Reverse Transkriptase (RT)-Aktivität in dem Zellkulturüberstand durch das Verfahren von Popovic et al. (1984) gemessen.

Fig. 16. V3-Loop-Peptide inhibieren eine HIV-1-Infektion von primären menschlichen T-Zellen. Mononukleäre Zellen aus dem peripheren Blut (PBMCs) von gesunden HIV-1-seronegativen Donoren wurden durch Ficoll-Hypaque- Zentriffigation aufgetrennt. Es wurde eine E-Rosettenbildung zur Herstellung einer T-Zell-angereicherten Lymphozytenpopulation eingesetzt wie durch Mannhalter et al. (1986) beschrieben. T-Zellen (1 · 10&sup6;/ml) wurden in Dreifachvertiefungen von Mikrotiterplätten mit 96 Vertiefungen mit Medium allein oder mit Kontrollen von nichtverwandtem Peptid (das einer Sequenz in dem c-mos- Protoonkogenprodukt entsprach) oder verschiedenen V3-Loop-Peptiden bei einer Konzentration von 1 ug/ml inkubiert. Andere Peptide sind: H13 N, V3-Loop- Peptid des Stamms HIV-1mn (seq id no: 7); T13Q, V3-Loop-Peptid des V3-Loops des Stamms HIV-1mn (seq id no: 6); RBK, ein 8 Aminosäuren umfassendes Peptid von dem V3-Loop des Stamms HIV-1 IIIB (seq id no: 5); N24G, ein 24 Aminosäuren umfassendes Peptid für den V3-Loop von HIV-1 IIIB (seq id no: 3); und R15K, ein 15 Aminosäuren umfassendes Peptid für den V3-Loop von HIV-1 IIIB (seq id no: 1). Nach 9 Tagen wurde die Reverse Transkriptase-Aktivität in Zellkulturüberstand gemäß dem Verfahren von Popovic et al. (1984) bestimmt.

Fig. 17. Serumstabilität von Peptid R15K: Das Peptid R15K (seq id no: 1) wurde bei 37ºC mit fötalem Kalbserum mit einer Konzentration von 100 ug/ml für 24 Stunden inkubiert. Nach verschiedenen Zeitintervallen wurden Aliquots von Peptid/Serum-Gemischen, die einer Endkonzentration von 1 ug/ml entsprachen, zu MT-4-Zellen in einer Mikrotiterplatte mit 96 Vertiefungen zugesetzt. Nach 15 Minuten Inkubation mit Peptid wurden die MT-4-Zellen mit HIV-1 wie in Fig. 13 beschrieben infiziert. Sieben Tage nach der Infektion wurde die Gesamtzahl an lebensfähigen Zellen durch den MTT-Farbstoffverringerungs-Assay (Larder et al., 1989) bestimmt. Die Kontrollen schlossen Zellen ein, die im Medium allein mit und ohne eine Virusinfektion inkubiert worden waren, und Zellen, die mit Virus infiziert und mit dem R15K-Peptid inkubiert worden waren, das nicht in fötalem Kalbserum vorinkubiert war.

Fig. 18. Peptid E13V (seq id no: 4) von der aminoterminalen Domäne von gp120 inhibiert eine HIV-1-Infektion von primären humanen T-Zellen. Die experimentellen Details sind die gleichen wie in Fig. 16 mit der Ausnahme, daß in diesem Experiment verschiedene Konzentrationen von Peptid E13V anstelle von R15K verwendet wurden.

Ausführliche Beschreibung der bevorzugten Ausführungsformen

AIDS ist eine hochinfektiöse und tödliche Krankheit, die durch eine Gruppe von nahe verwandten Retroviren verursacht wird, die gemeinhin als HIV bekannt sind. Es gibt gegenwärtig keine Vakzinen zur Verhinderung einer HIV-Infektion und keine wirksamen therapeutischen Mittel zum Anhalten des Fortschreitens, nachdem eine Infektion begonnen hat. Die vorliegende Erfindung ist auf beide dieser gegenwärtigen Schwächen gerichtet durch die Verwendung von Peptidtechnologie bei der Entwicklung von Formulierungen zur antiviralen Vakzinierung und Behandlung.

Anfänglich entwickelten die vorliegenden Erfinder ein schnelles Verfahren zur Identifizierung von Peptiden, die die Eigenschaft besitzen, eine spezifische CTL- Antwort in vivo zu induzieren. Dieses Verfahren ist weithin anwendbar auf sowohl das Durchmustern ("Screening") als auch die Vakzinierung und ist für die Entwicklung von vorbeugenden Vakzinen, nicht nur für AIDS, relevant, sondern auch für eine breite Vielzahl anderer Krankheiten. Diese Verfahren der CTL- Induktion wurden dann durch Zugabe von T-Helferzell-induzierenden Peptiden verfeinert, was zu besonders wirksamen Zusammensetzungen und Verfahren zur Erzeugung einer systemischen, langlebigen CTL-Antwort auf einem hohen Niveau in Antwort auf eine Peptidimmunisierung führte.

Zusätzlich zu Vakzineformulierungen haben die Erfinder ebenfalls Peptidsequenzen identifiziert, die bewirken, daß das Eindringen von HIV in menschliche Zielzellen auf wirksame Weise inhibiert wird. Es wird vorausgesehen, daß diese Peptide, die eine virale Infektion anhalten, die Basis von wirklichen Anti-HIV- Therapeutika bilden werden, die die virale Ausbreitung und den Fortschritt der Krankheit in HIV-infizierten Patienten anhalten werden.

Die Verwendung von Peptiden, zum Beispiel anstelle von Proteinen, bei klinischen Ausführungsformen, ist im allgemeinen aus verschiedenen Gründen bevorzugt. Diese schließen die geringen Kosten und die relative Einfachheit einer Herstellung im großen Maßstab und die Zuverlässigkeit des Produkts ein. Weiterhin sind ihre biologischen Eigenschaften bevorzugt, wie zum Beispiel die Einfachheit, mit der Peptide Gewebe durchdringen können und ihre geringe Immunogenität. Vor einer klinischen Verwendung können Peptide durch die Hinzufügung von Gruppen an die N- oder C-Termini, beispielsweise durch Acylierung oder Amidierung, stabilisiert werden. Die Formulierung der erfindungsgemäßen Peptide in verschiedene Polymere wird nachfolgend ausführlich diskutiert.

Ein neues und schnelles Verfahren zum Durchmustern von Kandidatenverbindungen, wie Peptiden oder deren Multimere, zur Identifizierung geeigneter CTL- induzierender aktiver Verbindungen zur Verwendung zum Beispiel in CTL- Vakzinen wird ebenfalls hierin beschrieben. In bevorzugten Verfahren zum Durchmustern werden Kandidatenpeptide oder -peptidmultimere einem Assay für eine in vivo-CTL-Induktion unterzogen, durch Injizieren der Testsubstanzen in ein Versuchstier, das Wiedergewinnen der T-Zellen aus den Lymphknoten und das Messen der Aktivität (Primen) derartiger CTLs. Auf besonders bevorzugte Weise würde eine Immunisierung eine einzige intradermale Injektion des Testpeptids in vollständigem Freundschem Adjuvans (CFA) in eine geeignete Stelle, wie das hintere Fußkissen einer Maus, das Wiedergewinnen von T-Zellen aus Lymphknoten, vorzugsweise von dem drainierenden poplitealen Lymphknoten (PLN), und das Bestimmen deren CTL-Aktivität mittels des Durchführens der T-Zellvermittelten Lyse von Zielzellen mit passendem MHC, die mit dem Kandidatenpeptid dekoriert sind oder das Ausgangsprotein exprimieren, beinhalten. Dieses Verfahren erlaubt, nach nur 8-10 Tagen nach Immunisierung Ergebnisse zu erhalten.

Der Einsatz eines derartigen Verfahrens zum Durchmustern wird zu der Identifizierung von T-Zell-aktiven Peptiden führen, sei es, daß sie Peptide sind, die im wesentlichen nur eine CTL-Antwort induzieren, oder auch eine Antikörperantwort induzieren (d. h. B-Zell-reaktiv). Eine Vielzahl von Mausstämmen, die in ihren Histokompatibilitätsgenen variieren, können für diese Verfahren zum Durchmustern eingesetzt werden. Peptide, die eine breite Antwort in verschiedenen MHC- Genotypen besitzen, sollten für eine weitere Studie in Primaten und schließlich Menschen ausgewählt werden. Beispielhafte Assayverfahren sind nachstehend zu finden.

Die Synthese von Peptiden kann unter Verwendung eines automatisierten Peptidsynthesegerätes erreicht werden. Beispielsweise können Peptide unter Verwendung des Festphasenverfahrens nach Merrifield synthetisiert werden (Merrifield, 1963), entweder auf einem modifizierten automatischen Peptidsynthesegerät des Typs Vaga 250 oder durch das "Bag"-Verfahren, wie von Houghton et al. (1985) beschrieben. Im Anschluß an die synthetischen Reaktionen werden dann die vollständigen Peptide wiedergewonnen. Bei den beiden vorgenannten Verfahren beinhaltet dies die Entfernung der T-BOC-Schutzgruppen und die Hydrolyse des Peptids von dem Harz unter Verwendung von Fluorwasserstoffsäure (HF)- Behandlung bei 0ºC für eine Stunde. Die verschiedenen organischen Nebenprodukte können dann zum Beispiel durch eine Extraktion mit Ether entfernt und die Peptide von dem Trägerharz mit einem Reagens wie 25%-iger Essigsäure extrahiert werden. Bei dem schnellen Verfahren zum Durchmustern zur Identifizierung von geeigneten CTL-induzierenden Kandidatenverbindungen haben die Erfinder festgestellt, daß die intradermale Immunisierung einer Maus auf vorteilhafte Weise eingesetzt werden kann. Es wird davon ausgegangen, daß eine intradermale Immunisierung besonders wirksam ist, da sie dazu dient, auf wirksame Weise den Zell-vermittelten Zweig des Immunsystems zu aktivieren. Die Erfinder haben festgestellt, daß sogar noch stärker vorteilhafte Aspekte dieses Immunisierungsprotokolls sind, daß (i) eine einzelne Injektion des Kandidaten gewöhnlicherweise ausreichen wird, um eine nachweisbare CTL-Aktivierung zu erzielen, und daß (ii) die Sensitivität des Assays derart ist, daß die Verwendung von Immunisierungsmodifikatoren im allgemeinen nicht erforderlich ist, um ein CTL-Primen zu erzielen.

Demgemäß werden in bevorzugten Ausführungsformen des Durchmusterns Mäuse durch eine intradermale Injektion in das hintere Fußkissen mit einer geeigneten Zusammensetzung, wie 100 ug des Testpeptids in einer 1 : 1-Emulsion mit vollständigem Freundschen Adjuvans (CFA) injiziert werden. Nach einer Zeitdauer, die zur Induzierung einer CTL-Antwort ausreicht, wie z. B. 10 Tagen, werden die drainierenden (ableitenden) poplitealen Lymphknoten (PLN) auf chirurgische Weise entfernt und die Zellen werden durch eine milde Homogenisierung abgetrennt. Die auf diese Weise erhaltenen PLN-Zellen, typischerweise zwischen 10- 50 · 10&sup6; Zellen/Lymphknoten/Maus, werden in 5-10 ml einer Lösung wie Click- Medium, 10% FCS, 50 uM 2-Mercaptoethanol, gehalten, und für 5 Tage in vitro mit bestrahlten (3300 Rad) syngenischen Mauszellen restimuliert, die mit dem Kandidatenpeptid vorbehandelt worden waren. Eine syngenische Zelle, die das Ausgangsprotein exprimiert, von dem das Peptid abgeleitet ist, wie das gp 160- Protein von HIV, würde eine geeignete Zielzelle sein. Die Erfinder ziehen jedoch in Erwägung, daß Peptid-dekorierte Milzzellen, die auf einfache Weise, zum Beispiel durch Vorbehandeln der Zellen mit dem Peptidmonomer bei einer Konzentration von ungefähr 40 ug/ml für 2 Stunden bei 37ºC, erzeugt werden können, für eine Verwendung bevorzugt sein können.

Die erneut stimulierten Effektorzellen werden dann gewaschen, zum Beispiel mit RPMI 1640-Medium, 10% FCS, resuspendiert bei einer geeigneten Zelldichte in dem Bereich von 5 · 10&sup6;/ml und dann einem Assay auf ihre CTL-Aktivität unterzogen. Ein geeignetes Verfahren zum Durchführen eines Assays auf CTL- Aktivität ist, das Freisetzen einer nicht-metabolisierbaren radiomarkierten Substanz aus spezifischen Zielzellen zu bestimmen, die zuvor mit der Substanz beladen wurden. Das Messen des Freisetzens von &sup5;¹Cr aus Peptid-behandelten syngenischen Zellen, wie durch Platsoucas & Good (1981) beschrieben, wird von den Erfindern als ein besonders geeignetes Verfahren betrachtet.

Um Peptid-exprimierende Zielzellen zur Verwendung in dem CTL-Assay zu erzeugen, werden geeignete syngenische Zellen, wie P815-Zellen, zuerst mit einer radioaktiven Verbindung, wie Chrom, beladen. Dies kann durch Inkubieren der Zellen für 2 Stunden bei 37ºC mit 250 uCi &sup5;¹Cr erreicht werden. Die Zellen werden dann dreimal gewaschen und für zusätzliche 2. Stunden bei 37ºC mit der monomeren Form des Testpeptids bei einer Konzentration von ungefähr 40 ug/ml inkubiert. Die Zellen werden dann zweimal mit einer Lösung wie RPMI-Medium 10% FCS, gewaschen, und dann bei einer geeigneten Konzentration resuspendiert, beispielsweise in dem Bereich von 5 · 10&sup4; Zellen/ml. Die auf diese Weise erzeugten Zielzellen können dann in dem CTL-Assay eingesetzt werden, zum Beispiel durch Mischen dieser mit den Kandidateneffektorzellen in Mikrotiterplatten mit 96 Vertiefungen, die einen U-förmigen Boden besitzen, derart, daß verschiedene Verhältnisse von Effektor- zu Zielzellen (E : T) erzielt werden.

Alternativ dazu können, wie vorstehend diskutiert, Zielzellen, die das Ausgangsprotein, aus dem das Testpeptid abgeleitet wurde, erzeugt und in dem CTL-Assay verwendet werden. Bei diesem Verfahren werden syngenische Zellen für 18-20 Stunden mit einer geeigneten Menge, wie 5 · 10&sup7; Plaque-bildenden Einheiten, an rekombinantem Vakziniavirus infiziert, der das Gen für das zu exprimierende Ausgangsprotein enthält. Als eine Kontrolle können syngenische Zellen mit rekombinantem Vakziniavirus infiziert werden, der das Gen für ein immunologisch nicht verwandtes Protein trägt. In diesem Stadium mag es gewünscht sein, das Vorkommen des erforderlichen Proteins in den Zielzellen, jedoch nicht in den Kontrollzellen, zu bestätigen, beispielsweise durch Western Blot beider infizierter Zelltypen mit spezifischen Antikörpern. Zielzellen, die auf diese Weise gebildet wurden, können dann mit der radioaktiven Verbindung markiert werden, in diesem Fall 100 uCi &sup5;¹Cr, und in dem Chromfreisetzungs-CTL-Assay (Platsoucas & Good (1981)), wie vorstehend beschrieben, verwendet werden.

In bestimmten Ausführungsformen, in denen die durchzumusternden Kandidatenpeptide von dem HIV-Protein gp160 abgeleitet sind, kann das rekombinante Vakziniavirus-System zur Herstellung von Zellen eingesetzt werden, die auf spezifische Weise dieses Protein exprimieren. Die Erfinder haben festgestellt, daß zur Verwendung in dieser Hinsicht die rekombinanten Kontroll-(VSC8)- und die HIV-env-exprimierenden (VPE16)-Viren, die durch Dr. Bernard Moss über das AIDS Research and Reference Reagent Program (Abteilung für AIDS, NIAID, NIH) erhalten wurden, von besonderem Nutzen sind. Die Erfinder haben festgestellt, daß es zweckmäßig ist, HIV-Antikörper-positive menschliche Seren in Western Blot-Experimenten einzusetzen, um das Vorkommen des gp160-Proteins in derartigen VPE16-infizierten P815-Zielzellen zu bestätigen. Bei der Verwendung der VPE16-infizierten P815-Zielzellen in CTL-Assays bestimmten die Erfinder, daß es besonders vorteilhaft ist, 5 · 10&sup4; Zielzellen/ml und 1 · 10&sup6; Kandidaten- CTL-Effektorzellen/ml, gemischt zum Erhalten eines anfänglichen E : T- Verhältnisses von 20 : 1, einzusetzen.

In CTL-Assays, die durchgeführt wurden unter Verwendung einer der vorgenannten Zielzellen, kann der Prozentsatz an spezifischer Freisetzung von &sup5;¹Cr wie folgt berechnet werden:

100 · (experimentelle Freisetzung - spontane Freisetzung)/(maximale Freisetzung - spontane Freisetzung)

Die maximale Freisetzung kann bestimmt werden durch Messen der Radioaktivität, die aus Zielzellen in den Überstand freigesetzt wird, wobei die vollständige Lyse der Zellen experimentell induziert wurde, wie durch Verwendung einer 5%- igen Lösung des nichtionischen Detergens Triton X-100 zum Zerstören der Zellmembranen. Das spontane Freisetzen kann bestimmt werden durch Messen der Radioaktivität, die aus Zielzellen, die ohne zugesetzte Effektorzellen inkubiert werden, in den Überstand freigesetzt wird. Es wird in Erwägung gezogen, daß valide Experimente einen Wert für eine spontane Ziellyse besitzen werden, der zwischen 15-20% der beobachteten maximalen Lyse ist.

Bevor man die PLN-Zellen auf mögliche CTL-Aktivität durchmustert, mag man wünschen, zuerst eine Verringerung bestimmter Zellpopulationen wie CD4&spplus; oder CD8&spplus; aus dem Gemisch von Zellen zu erzielen. In dieser Hinsicht können erneut stimulierte PLN-Zellen mit entweder einem monoklonalen Anti-CD4-Antikörper (Klon GK-1.5) plus Complement (C) (+ anti CD4+C) oder mit monoklonalem Anti-CD8-Antikörper (Klon 53-6.72) plus C (+ anti CD4+C) behandelt werden, wie durch Platsoucas & Good (1981) beschrieben. Es kann auch wünschenswert sein, bestimmte PLN-Zellen mit Complement allein (+C) zu behandeln, um als ein Vergleich zu dienen. Zellen, die auf eine beliebige dieser Arten behandelt wurden, können dann auf ihre Fähigkeit getestet werden, Zielzellen mit passendem MHC zu lysieren, die mit der monomeren Form des Peptids vorbehandelt worden sind oder mit dem rekombinanten Vakziniavirus vorbehandelt sind, der das Ausgangsprotein exprimiert, aus dem das Testpeptid abgeleitet wurde.

Wenn man wünscht, CTL-reaktive Verbindungen zu identifizieren, die nicht die Fähigkeit aufweisen, Antikörper zu bilden, können Peptide, die als T-Zell-aktiv identifiziert wurden, durchgemustert werden, um solche zu identifizieren, denen eine B-Zell-stimulatorische Aktivität fehlt. Es wird vorgeschlagen, daß derartige Peptide bei der Herstellung von Vakzinen zur Behandlung oder Vorbeugung viraler Krankheiten wie AIDS, bei denen eine Antikörperantwort tatsächlich die Infektiösität des verursachenden Agens erhöhen kann, besonders nützlich sind. Die Identifizierung derartiger Peptide wird erzielt, indem ein Kandidat in ein immunkompetentes Tier (z. B. Mäuse) injiziert wird, um solche Peptide zu identifizieren, die nicht eine signifikante Antikörperantwort auf das native Protein bilden können, deren Sequenz die Peptide teilweise entsprechen. Beispielsweise würde man im Fall von HIV wünschen, auf die Erzeugung von Antikörpern mit einer Reaktivität gegen gp120, gp41 oder Kernproteinen, etc. zu testen.

Natürlich betrifft die vorliegende Offenbarung wie vorstehend erwähnt auch die Identifizierung von Verbindungen, die sowohl eine T-Zell-Antwort als auch eine B-Zell-Antwort hervorrufen können insofern, als diese letztere Gruppe dazu dienen wird, eine schützende auf Antikörpern basierende Immunität in dem immunisierten Wirt zu induzieren.

CTL-aktive Zusammensetzungen der vorliegenden Erfindung primen T-Zellen auf eine Weise, daß, wenn das infizierende Virus zu einem späteren Zeitpunkt erscheint, T-Gedächtniszellen aktiviert werden mit einer resultierenden zellvermittelten Immunantwort, die Zielzellen zerstört, die das entsprechende Zielprotein oder ein Teil davon auf deren Zelloberflächen besitzen und somit den Virus.

Die Erfinder haben weiterhin das vorstehend beschriebene Verfahren zur Erzeugung von Peptid-induzierten CTL-Antworten gegen Peptidimmunogene optimiert. Besondere Ziele waren hierbei das Erhöhen einer spezifischen CTL-Erzeugung durch lymphoides Gewebe an einem von der Injektionsstelle entfernteren Ort, wie der Milz, und die Verbesserung der Langlebigkeit der Antwort. Es wurde bestimmt, daß das auf physikalische Weise erfolgende Mischen von Peptiden, die T- Helferepitopsequenzen enthalten, mit CTL-induzierenden Peptiden CTL- Antworten in Mäusen verstärkte, sowohl im Anschluß an mehrfache subkutane (sc) Injektionen als auch von einzelnen intradermalen (id) Injektionen in das Fußkissen. Zusätzlich wurde das hohe Niveau der CTL-Antwort in der Milz für bis zu acht Wochen nach einer id-Injektion aufrecht erhalten. Ein Beispiel eines geeigneten T-Helferpeptids ist C19A, das die Sequenz CRIKQIINMWQGVGKAMYA (seq id no: 2) besitzt, von der festgestellt wurde, daß sie in monomerer Form, mit einem Lipid-Schwanz versehener Form und als Disulfidpolymerform wirksam ist.

Der Mechanismus des Verstärkens einer Peptid-induzierten CTL-Antwort in vivo durch Peptide, die T-Helferzellen induzieren, ist nicht bekannt. Es ist jedoch wahrscheinlich, daß das verstärkende Peptid aufgrund seiner Fähigkeit, T- Helferzellen zu induzieren, zu einer Erhöhung der Werte an notwendigen Cytokinen führen wird, die bei der klonalen Expansion und Verbreitung assistieren. Unabhängig von dem zugrundeliegenden Mechanismus wird vorausgesehen, daß die Verwendung von Gemischen von T-Helferzell- und CTL-induzierenden Peptiden bei der Immunisierung oder Vakzinformulierung die Fähigkeit der Bildung einer systemischen CTL-Antwort mit relativ langer Halbwertszeit im Vergleich zu einer Immunisierung mit dem oder den CTL-induzierenden Peptiden allein stark verbessern wird.

In Hinsicht auf HIV wird vorgeschlagen, daß besonders nützliche Peptide, gegen die eine CTL-Antwort zu erzeugen ist, solche sein werden, die Sequenzen besitzen, die von den viralen Genen gag-, pol-, nef- und env-Genen abgeleitet sind (TABELLE 1), wobei die env-Gene besonders bevorzugt sind. Sogar noch stärker bevorzugt ist, daß Peptide mit Sequenzen, die von dem V3-Loop von HIV-gp120, wie jene in TABELLE 2 aufgeführten, als CTL-induzierende Peptide eingesetzt werden können. Man stellt sich vor, daß T-Helferzell-induzierende Epitope zur Verwendung in der vorliegenden Erfindung im allgemeinen einen amphipathischen Wert von ungefähr plus 10 bis ungefähr plus 20 besitzen werden.

Peptide und Peptidkombinationen, die als Vakzinen oder deren Komponenten geeignet betrachtet werden, können in experimentellen Tiermodellen, wie Mäusen, Ratten, Kaninchen, Meerschweinchen, Rhesusaffen, Schimpansen und dergleichen getestet werden. Derartige Tests werden wahrscheinlich zu der Herstellung von erfolgreichen Vakzinen führen, die eine zellvermittelte Immunität zum Schutz gegen eine Vielzahl infektiöser Agenzien induzieren.

Weitere Aspekte betreffen die Identifizierung und Formulierung von synthetischen Peptiden als therapeutische Agenzien zur Verwendung gegen HIV, derart, daß diese chemisch definierten synthetischen Peptide menschliche Zellen vor einer HIV-1-Infektion schützen werden.

Es ist bekannt, daß die V3-Loop-Region von gp120 für eine HIV-1-Infektion von Zellen essentiell ist (Travis et al., 1991; Freed und Riser, 1987; Freed et al., 1991). Es gezeigt worden daß Anti-V3-Loop-Antikörper eine HIV-1-Infektion von Zellen inhibieren, ohne mit der Bindung von gp120 an seinen zellulären Rezeptor, CD4, zu interferieren (Linsley et al., 1988; Javaherian et al., 1989). Es ist auch bekannt, daß die V3-Loop-Region ein Ziel für eine Trypsin-verwandte Protease auf der Wirtszelloberfläche ist (Murakami et al., 1991). Es ist spekuliert worden, daß nachdem gp120 an CD4 bindet, der V3-Loop durch eine Zelloberflächenprotease gespalten wird, was zu einem Konformationswechsel in dem gp120/gp41- Proteinkomplex führt (McCune et al., 1988). Eine derartige Veränderung kann dann die fusogene Domäne in dem Transmembranprotein gp41 exponieren, was zu der Fusion der viralen Partikelmembran mit der Zellmembran führt. Die Erfinder haben deswegen den Schluß gezogen, daß V3-Loop-Peptide eine Infektion von Zellen verhindern können, indem sie die Spaltung des gp120-V3-Loops inhibieren.

Jüngste Studien in diesem Bereich führten zu der Bildung von widerstreitenden Ergebnissen. Koito et al. (1989) berichtete, daß ein synthetisches Peptid, das dem bedeutenden HIV-1-neutralisierenden Epitop aus dem V3-Loop von gp120 entspricht, die Bildung eines Syncytiums zwischen HIV-1-infizierten CCRF-CEM- und uninfizierten Molt-4-Zellen auf eine dosisabhängige Weise inhibiert. Bei diesen Studien wurde festgestellt, daß das 36 Aminosäuren umfassende Peptid (Reste 303-338), CTRPNNNTRKSIRIQRGPGRAFVTIGKIGNMRQAHC, das den gesamten V3-Loop darstellt, die Bildung eines Syncytiums bei 30-60% bei einer Konzentration von 100 uM (ungefähr 300 ug/ml) inhibiert. Ein 24 Aminosäuren umfassendes Peptid (Reste 308-331, NNTRKSIRIQRGPGRAFVTIGKIG), das den mittleren Teil des V3-Loops darstellt, war jedoch weniger wirksam und war in einer Konzentration von 300 uM (ungefähr 720 ug/ml) erforderlich, um das gleiche Niveau an Inhibierung der Bildung eines Syncytiums zu erzielen. Keines dieser Peptide wurde auf seine Fähigkeit getestet, eine HIV-Infektion von Zellen zu inhibieren.

Im Gegensatz dazu berichteten De Rossi et al. (1991) kürzlich, daß synthetische Peptide mit einer Länge von 24 Aminosäuren aus V3-Loop-Regionen verschiedener HIV-1-Isolate tatsächlich eine HIV-1-Infektion von Zellen durch einen CD4- abhängigen Mechanismus verstärken. Bei diesen Experimenten wurden synthetische Peptide bei Konzentrationen in einem Bereich von 0,62-20 uM (ungefähr 1,5-48 ug/ml) eingesetzt und es wurde eine menschliche T-Zellinie (Molt-3) getestet.

Trotz des vorangehenden gegenteiligen Befunds fuhren die vorliegenden Erfinder fort, die Fähigkeit von synthetischen V3-Loop-Peptiden, eine HIV-Infektion zu inhibieren, zu testen. Es wurde bestimmt, daß synthetische Peptide variierender Länge (8-24 Aminosäuren), die aus dem V3-Loop von gp120 ausgewählt waren, überraschend wirksam bei der Inhibierung einer HIV-Infektion von T-Zellen waren bei Verwendung von sowohl kultivierten menschlichen T-Zellen wie H9-, CEM- und MT-4- als auch frisch hergestellten primären menschlichen T-Zellen. Diese Peptide umfassen R15K, das die Sequenz RIQRGPGRAFVTIGK (seq id no: 1) besitzt und N24G, das die Sequenz NNTRKSIRIQRGPGRAFVTIGKIG (seq id no: 3) besitzt. Es wurde ebenfalls festgestellt, daß die Peptide, die D23, D24, D25, D26, D30, D35, D38, D39 und D40 bezeichnet wurden, deren Sequenzen in TABELLE 11A gezeigt sind, eine zelluläre Infektion durch HIV inhibieren.

Eine wichtige Entdeckung dieser Erfindung ist der Befund, daß Peptide mit Sequenzen aus einer Vielzahl verschiedener HIV-Isolate die Fähigkeit besitzen, eine Infektion von Zellen durch HIV-1 IIIB zu inhibieren. Diese schließen H13N (HIGPGRAFYTTKN, seq id no: 7) von HIV-1mn, und T13Q (TKGPGRVIYATGQ, seq id no: 6) von HIV-1rf sowie die in TABELLE 11A ausführlich aufgeführten Peptide ein. Bedeutenderweise wird in Erwägung gezogen, daß Peptide mit Sequenzen, die V3-Loop-Sequenzen anderer viraler Stämme entsprechen, ebenfalls bei der Inhibierung einer Infektion durch den homologen oder andere verwandte HIV-Stämme nützlich sein werden. Als solches wird in Erwägung gezogen, daß Peptide wie D27, D28, D29, D31, D32, D33, D34 und D37 (TABELLE 11B) noch als Infektions-inhibierende Peptide nützlich gefunden werden können.

Die Erfinder haben zuvor gezeigt, daß das Peptid EQLWVTVYYGVPV (E13 V, seq id no: 4) aus dem Aminoterminus von gp120 (Reste 39-51) in der Lage ist, anti-HIV-T-Helferzell-Antworten in Mäusen zu induzieren (Sastry & Arlinghaus, 1991). Es wurde festgestellt, daß Antikörper gegen dieses Peptid in der Lage sind, denaturiertes, aber nicht natives gp 120 zu binden. Beim Analysieren der Fähigkeit des Peptids E 13 V (seq id no: 4) mit dem Eindringen von HIV in Zellen zu interferieren und auf diese Weise eine Infektion zu inhibieren, stellten die Erfinder fest, daß es ebenfalls ein wirksames Infektions-Inhibitorpeptid ist.

Die Infektions-Inhibitorpeptide der vorliegenden Erfindung wie R15K (seq id no: 1) und E13V (seq id no: 4) stellt man sich ebenfalls als ideale Kandidaten für eine Aufnahme in therapeutische Formulierungen vor, die bei der Verhinderung einer Infektion von menschlichen Zellen durch HIV-1 wirksam sein werden. Für eine Therapie beim Menschen ist der Befund von Bedeutung, daß R15K beispielsweise seine inhibitorische Aktivität in voller Stärke nach einer Inkubation in fötalem Kalbserum für bis zu 4 Stunden behält. Da derartige Formulierungen vollständig synthetisch und definiert sein werden, werden diese Reagenzien sowohl ökonomisch als auch sicher sein. Die V3-Loop-Peptide als ein Gemisch werden ebenfalls den zusätzlichen Vorteil bereitstellen, daß sie ein immuntherapeutisches Reagens sind wegen der Fähigkeit des Induzierens von HIV-1-spezifischen CTL- Antworten, die auf wirksame Weise sämtliche Virusinfizierten Zellen töten können, während sie eine frische Infektion von Zellen verhindern.

Somit beinhaltet die vorliegende Offenbarung schließlich die Herstellung von sowohl Vakzinen als auch therapeutischen Formulierungen, die synthetische Peptide beinhalten. Man stellt sich vor, daß die Vakzinen ein Peptid bzw. Peptide einschließen, die CTL-induzierende Epitope tragen und idealerweise ebenfalls ein Peptid bzw. Peptide einschließen, die T-Helferzell-induzierende Epitope tragen. Die therapeutischen Formulierungen können natürlich auch derartige Sequenzen einschließen. Die vorliegende Offenbarung betrifft Peptide, die eine HIV- Infektions-inhibierende Sequenz umfassen, zur Verwendung als Bestandteile einer derartigen therapeutischen Zusammensetzung.

In Hinsicht auf Vakzine-artige Peptide der vorliegenden Erfindung wird in Erwägung gezogen, das Peptidmultimere bei der Herstellung von CTL-induzierenden Vakzinen in Übereinstimmung hiermit besonders vorteilhaft sein können. Bevorzugte Multimere werden durch oberflächenaktives Mittel-artige Mizellen und Polymere gebildet. Zusätzlich zu dem aminoterminalen Lysylrest kann das Spacerpeptid ein bis ungefähr fünf zusätzliche Reste enthalten. Es kann im wesentlichen jeder beliebige Aminosäurerest verwendet werden, solange er nicht mit der Fähigkeit zur T-Zell-Immunisierung einer wäßrigen Zusammensetzung interferiert, die das Multimer enthält oder mit der Fähigkeit des Diamidreaktionsproduktes, oberflächenaktives Mittel-artige Mizellen in einer wäßrigen Zusammensetzung zu bilden. Es sind ein bis ungefähr drei Glycylreste pro Spacerpeptid bevorzugt.

Das zuvor beschriebene Peptid und der aminoterminale Lysylrest enthaltende Peptidspacer sind über eine Peptidbindung miteinander verbunden und können somit als ein zusammengesetztes Polypeptid (Verbundpolypeptid) gesehen werden. Das nützliche Diamid ist somit ein Reaktionsprodukt der Alpha- und Epsilon-Aminogruppen des aminoterminalen Lysylrests und zwei Mol pro zusammengesetztem Polypeptid der C&sub1;&sub2;-C&sub1;&sub8;-Fettsäure. Das zusammengesetzte Polypeptid kann somit als eine einzelne Sequenz hergestellt und vor oder nach Entfernung von dem Harz, wenn eine Festphasensynthese angewendet wird, durch konventionelle Techniken amidiert werden.

Der Begriff "oberflächenaktives Mittel-artige Mizelle" wird hierin verwendet, um zu betonen, daß das Diamidolysyl-Verbundpolypeptid in einer wäßrigen Lösung Mizellen zu bilden scheint, die ähnlich denen sind, die durch oberflächenaktive Mittel gebildet werden und um derartige Multimere von submikroskopischen Struktureinheiten von Protoplasma zu unterscheiden, die aus polymeren Molekülen gebildet werden, die manchmal ebenfalls als Mizellen bezeichnet werden. Das Wort "Mizelle" wird ebenfalls manchmal hierin benutzt, und wenn es so verwendet wird, besitzt es die gleiche Bedeutung wie oberflächenaktives Mittel-artige Mizelle.

Eine andere Multimerform eines zuvor beschriebenen Peptids ist ein Polymer mit einer Vielzahl von Peptidgrundeinheiten. In diesem Fall kann ein Peptid, das zwei terminale Cysteine als Teil seiner natürlichen Sequenz enthält, ausgewählt und synthetisiert werden. Ein Peptid, dem derartige Cysteine fehlen, kann durch das Hinzufügen von zwei oder mehr zusätzlichen Cysteinen an die N- bzw. C- terminalen Enden modifiziert werden. Die Gegenwart von zwei Cysteinen pro Peptid erlaubt eine Polymerisation des Untereinheitpeptids durch Luftoxidation unter Bildung von oxidierten Cystein (Cystin)-verknüpften Polymeren und/oder zyklischen Peptiden. Derartige Multimere verstärken eine Immunerkennung des Peptids ohne einen Bedarf an Träger.

Das Lysin-terminierte Spacerpeptid kann ein bis ungefähr fünf Aminosäurereste zusätzlich zu dem Lysylrest enthalten, und die ein oder zwei hinzugefügten terminalen Cysteinreste sind nicht beim Zählen der Länge eines erfindungsgemäßen Peptids mitumfaßt. Das Peptid, das terminale Cysteinreste enthält, wird als ein di- Cystein-terminiertes Peptid oder einfacher als ein di-Cys-Peptid bezeichnet. Im folgenden werden Einzelheiten zur Herstellung von Polymeren, die di-Cys- Peptidgrundeinheiten enthalten, bereitgestellt.

Erfindungsgemäße wäßrige Zusammensetzungen (Inocula) umfassen eine immunologisch wirksame Menge eines CTL-induzierenden, T-Helferzell-induzierenden oder HIV-Infektions-inhibierenden Peptids oder Peptiden, sei es in multimerer Form oder nicht, gelöst oder dispergiert in einem pharmazeutisch verträglichen wäßrigen Medium. Derartige Zusammensetzungen werden ebenfalls als Inocula bezeichnet.

Der Ausdruck "pharmazeutisch verträglich" bezeichnet molekulare Einheiten und Zusammensetzungen, die nicht eine allergische oder ähnliche unerwünschte Reaktion erzeugen, wenn sie einem Menschen verabreicht werden.

Die Herstellung einer wäßrigen Zusammensetzung, die ein immunisierendes Molekül wie ein Peptid oder Multimer oder einen Infektions-inhibierenden Bestandteil wie ein Peptid als einen aktiven Bestandteil enthält, ist im Stand der Technik wohlbekannt. Typischerweise werden derartige Zusammensetzungen hergestellt als Injektionslösungen, entweder als flüssige Lösungen oder Suspensionen; feste Formen, geeignet zur Lösung in oder Suspension in einer Flüssigkeit vor der Injektion können ebenfalls hergestellt werden. Die Zubereitung kann auch emulgiert werden.

Ein Peptid oder Peptidmultimer kann in einer neutralen oder Salzform in eine Zusammensetzung formuliert werden. Pharmazeutisch verträgliche Salze schließen die Säureadditionssalze (gebildet mit den freien Aminogruppen des Peptids) ein, die mit anorganischen Säuren wie beispielsweise Salzsäure oder Phosphorsäure oder organischen Säuren wie Essigsäure, Oxalsäure, Weinsäure, Mandelsäure und dergleichen gebildet werden. Salze, die mit den freien Carboxylgruppen gebildet werden, können ebenfalls von anorganischen Basen wie beispielsweise Natrium-, Kalium-, Ammonium-, Calcium- oder Eisenhydroxiden und derartigen organi schen Basen wie Isopropylamin, Trimethylamin, Histidin, Procain und dergleichen abgeleitet werden.

Nach der Formulierung werden die Vakzinen auf eine Weise verabreicht, die mit der Dosisformulierung vereinbar ist, und in einer Menge, wie sie immunologisch wirksam ist. Wie hierin verwendet, bedeutet der Ausdruck "immunologisch wirksame Menge", daß eine Menge an Zusammensetzungen eingesetzt wird, die eine Menge an Peptid, Peptiden oder Peptidmultimeren enthält, die ausreicht, um eine wirksame CTL-Antwort in dem Wirtstier (Säugetier) zu induzieren, wie durch die Induzierung von auf spezifische Weise als Ziel bestimmten ("specifically targeted") cytotoxischen T-Zellen. In bevorzugten Ausführungsformen wird auch in Erwägung gezogen, daß die immunologisch wirksame Vakzine-Zusammensetzung ebenfalls eine Menge eines Peptids, von Peptiden oder Peptidmultimeren enthält, die das Induzieren einer T-Helferzell-Aktivität bewirken und auf diese Weise eine Verstärkung der CTL-Wirkung bewirken. Das Vorkommen derartiger cytotoxischer T-Zellen wird mit einem Assay, wie nachfolgend diskutiert, untersucht.

Im Zusammenhang mit einer Vakzine hängt die Menge an Peptid bzw. Peptiden und das Volumen der zu verabreichenden Zusammensetzung von dem zu immunisierenden Wirtstier, der Fähigkeit des Immunsystems des Wirtstieres zur Aktivierung von T-Zellen, und dem gewünschten Grad an Schutz ab. Die genauen Mengen an aktivem Peptidmultimer, die zur Verabreichung erforderlich sind, hängen von der Beurteilung des Arztes ab und sind für jedes Individuum eigentümlich. Jedoch werden geeignete Dosisbereiche in der Größenordnung von ungefähr 10 Mikrogramm (ug) bis ungefähr 500 Milligramm (mg), vorzugsweise etwa 50 ug bis ungefähr 1 mg, und besonders bevorzugt ungefähr 100 ug an aktivem Bestandteil des Peptidmultimers pro Individuum sein. Ein minimales Volumen einer Zusammensetzung, die benötigt wird zum Dispergieren der immunisierenden Menge an Peptidmultimer wird typischerweise eingesetzt. Geeignete Therapien für die anfängliche Verabreichung und Wiederauffrischimpfungen sind ebenfalls variabel, werden aber bezeichnet sein durch eine anfängliche Verabreichung, ge folgt in Intervallen von einer oder zwei Wochen von einer anschließenden Injektion oder anderen Verabreichung.

Eine Zusammensetzung kann ebenfalls ein Adjuvans als Teil des Arzneimittelträgers enthalten. Adjuvanzien wie das vollständige Freundsche Adjuvans (CFA), das unvollständige Freundsche Adjuvans (IFA) zur Verwendung in Laborwirtssäugetieren sind im Stand der Technik wohlbekannt und werden hierin beispielhaft verwendet. Pharmazeutisch verträglich Adjuvanzien wie Alaun können ebenfalls verwendet werden.

BEISPIEL 1 - Herstellung von Peptiden, Peptidpolymeren und Peptidmizellen

Synthetische Peptide von 7 bis ungefähr 30 Aminosäureresten in Länge wurden hergestellt entsprechend den ausgewählten konservierten Domänen der Kern- und gp160 (gp120 und gp41)-Moleküle unter Verwendung der Festphasentechnik nach Merrifield (1963) unter Verwendung eines modifizierten automatischen Peptidsynthesegerätes Vega 250 oder durch das "Bag"-Verfahren, das in Houghten (1985) beschrieben wurde. In beiden Fällen wurde die Entfernung der t- Butyloxycarbonyl (t-Boc)-Aminosäureschutzgruppen und die Hydrolyse des Peptids von dem Harz durch Behandlung mit Flußsäure (HF) bei 0ºC für eine Stunde erreicht. Das Peptid enthaltende Gemisch wurde dann mit Diethylether extrahiert, um organische Nichtpeptidverbindungen zu entfernen und die synthetisierten Peptide wurden aus dem Harz mit 25%-iger Essigsäure (w/v) extrahiert.

Verschiedene synthetische Peptide sind durch dieses Verfahren hergestellt worden, einschließlich neunzehn (19), die konservierten Domänen des gp120- Moleküls und des gp41-Moleküls entsprechen, wie in TABELLE 3 aufgeführt. Die synthetisierten Peptide entsprechen bezeichneten konservierten Domänen (Regionen) von gp160 in HIV wie im folgenden gezeigt.

TABELLE 3 AMINOSÄURESEQUENZ DER SYNTHETISCHEN PEPTIDE

1. Die N- und C-terminalen Aminosäurereste jedes Peptids werden entsprechend ihrer Position in der Aminosäurerestsequenz von gp 160 gemäß Modrow et al., Virol. 61: 570 (1987) numeriert. Ein Bindestrich (-) zeigt an, daß die Sequenz in der nächsten Zeile fortgesetzt wird.

2. CR = Konservierte Region

Es wurden zwei Arten von Formen mit hohem Molekulargewicht (multimere Formen) der in TABELLE 3 aufgeführten Peptide hergestellt. Die Hauptform des Multimers war ein di-Cystein (di-Cys)-terminiertes Polymer, in dem eine Vielzahl von Peptiden durch Disulfidbindungen mit einem Ende an das nächste Ende verknüpft waren. Diese di-Cysteinpolymere wurden durch Hinzufügen von Cysteinresten an die Termini jedes Peptids während der Synthese erzeugt. Die di-Cysteinterminierten (di-Cys)-Peptide wurden dann in Ammoniumbicarbonat (0,1M) bei Raumtemperatur (~25ºC) gelöst (10 mg/ml) und für ungefähr 16 Stunden gerührt, um eine Oxidation der Sulfhydrylgruppen unter Erzeugung von Polymerformen der Peptide zu bewirken. Die Peptidlösung wurde dann gefriergetrocknet und durch HPLC analysiert, um das Vorliegen von Polymerformen des Peptids zu bestätigen.

Die zweite Art einer Form mit hohem Molekulargewicht, die erzeugt wurde, war eine oberflächenaktives Mittel-artige Mizelle, die durch Verknüpfung eines aminoterminalen Lysin enthaltenden Spacerpeptids (Lys-Gly-Gly-) an die Peptidsequenz gebildet wurde, um ein Verbundpolypeptid zu bilden und dann Koppeln einer C&sub1;&sub2;-C&sub1;&sub8;-Fettsäure, wie Palmitinsäure, sowohl an die Alpha- als auch Epsilon-Aminogruppen, wie in Hopp (1984) beschrieben. Die C&sub1;&sub2;-C&sub1;&sub8;-Fettsäure enthaltenden Peptide, die erzeugt wurden, wurden dann in 95%-iger Essigsäure extrahiert und benutzt, um große Mizellen in der wäßrigen Zusammensetzung zu bilden, die eine erhöhte Immunogenität in bezug auf die Peptide zeigen.

Es wurden di-Cys-Polymermultimere aller in TABELLE 3 aufgeführten Peptide hergestellt. Es sind wäßrige Peptidmizellenmultimere von Peptiden, bezeichnet 61, 63, 65, 67, hergestellt worden und wurden als Peptide 62, 64, 66 bzw. 68 bezeichnet. Die Peptide, die mit 103 bis 117 bezeichnet wurden, wurden nur in ihren di-Cys-Polymer-Multimerformen eingesetzt.

Die erzeugten multimeren Formen mit hohem Molekulargewicht entsprechen mehreren Kopien von spezifischen Regionen von gp120 und gp41 in HIV. Zur Einfachheit der Bezeichnung werden die multimeren Formen durch die Nummer des Peptids, aus dem Sie bestehen, bezeichnet werden - das heißt, Peptid 61 bezieht sich auf die di-Cys-Multimer (Polymer)form von Peptid 61 und Peptid 66 bezieht sich auf die wäßrige Mizellenform von Peptid 65, während Peptid 103-117 sich auf ein polymeres Multimer bezieht.

Die Peptide 65 und 66 entsprechen der Region des gp120, die an den T4- Zelloberflächenrezeptor bindet. Die Peptide 61 und 62 entsprechen einer Region nahe des aminoterminalen Anteils von gp41, der ein bedeutendes immundominantes Epitop darstellt, das in den Seren von AIDS-Patienten gesehen wird.

BEISPIEL 2 - Anti-Peptid-Antikörperantwort

Wäßrige Zusammensetzungen der Multimere, d. h. die di-Cys-Peptidpolymere und -mizellen, die in BEISPIEL 1 erzeugt wurden, wurden auf ihre Fähigkeit oder das Fehlen der Fähigkeit durchgemustert, eine Anti-Peptid-Antikörperantwort in BALB/c-Mäusen hervorzurufen, einem immunkompetenten Mausstamm.

Gruppen von BALB/c-Mäusen (6-8 Wochen alte Weibchen, 3 bis 5 Mäuse/Gruppe, Charles River Laboratories) wurden durch subkutane (sc) oder intraperitoneale (ip) Injektion eines Peptidmultimers (100 ug/Injektion) in vollständigem Freundschen Adjuvans (CFA) (1 : 1-Verhältnis) immunisiert. Auffrischinjektionen (50 ug an Peptidmultimer) in unvollständigem Freundschem Adjuvans (IFA) (1 : 1) wurden dann 6 und 10 Wochen nach der anfänglichen Immunisierung gegeben. Jeder Maus wurde aus ihrem retro-orbitalem Plexus Blut in Zweiwochen- Intervallen entnommen und das Serum wurde für die individuellen Mäuse in jeder Gruppe gepoolt.

Ein ELISA-Assay wurde für jedes Serum durchgeführt, um die Gegenwart von Anti-Peptid-Antikörpern festzustellen, wobei Peroxidase-konjugierter Ziege-anti- Maus-IgG (Boehringer Mannheim Biochemicals, Indianapolis, IN) als der zweite Antikörper benutzt wurde. Die vorläufigen Ergebnisse für die Peptide 61-68 sind in TABELLE 4 gezeigt, weitere verfeinerte Ergebnisse für die Peptide 61, 63, 65, 67 und 103-117 sind in TABELLE 5 gezeigt.

Es wurde festgestellt, daß die Formen mit hohem Molekulargewicht von Peptiden 65, 66, 67, 68, 105-110, 112, 114, 115 und 117 hohe Antikörpertiter hervorrufen, während die Peptide 61, 62, 63, 64, 103, 104, 111, 113 und 116 sehr geringe bis vernachlässigbare Mengen an Anti-Peptid-Antikörpern erzeugten. Ähnliche Ergebnisse wurden für Antikörperantworten in B6C3 F1-Mäuse (Charles River Laboratories), einen anderen immunkompetenten Stamm, erhalten.

Einige der Seren wurden weiterhin einem Assay auf Antikörperantwort (Reaktivität) mit nativem gp160 unterzogen, und die Ergebnisse, gezeigt in TABELLE 6, zeigen, daß diese Peptide nicht B-Zell-Epitope darstellen, da es keine Immunreaktion mit nativem gp160 gab. TABELLE 4

ANTIKÖRPERANTWORT VERSCHIEDENER PEPTIDE IN BALB/C-MÄUSEN ELISA-Titer in Blut 1
TABELLE 5 ANTIKÖRPERANTWORT VERSCHIEDENER PEPTIDE IN BALB/C-MÄUSEN
TABELLE 6 T- UND B-ZELLANTWORTEN IN MÄUSEN GEGEN HIV-HÜLL-GP160 ABGELEITETE SYNTHETISCHE PEPTIDIMMUNOGENE

* Die cpm-Werte wurden korrigiert und gemäß der nicht verwandten Antigen- Antwort in vitro kategorisiert.

** In BALB/c-Mäusen hervorgerufene Antikörper; Reaktivität gemessen durch ELISA und gemäß dem Endpunkt kategorisiert.

Nicht bestimmt.

BEISPIEL 3 - T-Zell-Antworten

Die multimeren di-Cys-Peptid-Polymerformen mit hohem Molekulargewicht der in BEISPIEL 1 beschriebenen Peptide wurden einem Assay unterzogen auf ihr Hervorrufen einer T-Zell-proliferativen Antwort wie in Millich et al. (1985) beschrieben.

Mäuse (3 oder 5 Mäuse/Gruppe) wurden in das rechte hintere Fußkissen mit einem 1 : 1-Gemisch des Peptidpolymers (100 ug/Injektion) und CFA injiziert. Die Peptide 61, 63, 65 und 67 wurden in B6C3 F1-Mäuse (H-2kxb, Charles River Laboratories) und A. SWxBALB/c F1-Mäuse (H-25sxd, Jackson Labs, Bar Harbor, ME) injiziert. Ableitende popliteale Lymphknoten (PLN)-Zellen wurden nach zehn (10) Tagen geerntet und in Mikrotiterplatten mit 96 Vertiefungen kultiviert (2 · 10&sup5; Zellen/Vertiefung) in 0,2 ml Click-Medium (dick et al., 1972), enthaltend verschiedene Konzentrationen an synthetischem Peptid, gp160, einem nicht verwandten proteinartigen Material oder Medium allein, für 96 Stunden bei 37ºC in einer angefeuchteten Atmosphäre von 5% CO&sub2;. Während der letzten 16-18 Stunden der Kultivierung wurde ³H-Thymidin (³H-TdR) (1 uCi/Vertiefung, 6-7 Ci/mMol, ICN Radiochemicals) zugegeben. Die Zellen wurden auf Filterstreifen geerntet und der ³H-TdR-Einbau wurde verfolgt. Die Daten sind in Fig. 1, 2, 3, 4 und 5 dargestellt.

Fig. 1 veranschaulicht die Ergebnisse für Peptide 61, 63, 65, 67 in BALB/c- Mäusen, und solche Ergebnisse sind als ein Stimulationsindex (SI) ausgedrückt, was den mehrfachen Anstieg der Radioaktivitäts-Zählimpulse in Gegenwart von Antigen im Vergleich zu Hintergrundwerten, bei denen kein Antigen zugesetzt wurde, darstellt. Die SI-Werte mit den verschiedenen Peptiden wurden verglichen mit denen, die mit Tuberculin-gereinigtem Proteinderivat (PPD) als einem positiven Kontrollantigen erhalten wurden.

Fig. 2-5 veranschaulichen den Peptid-spezifischen ³H-TdR-Einbau für T- Zell-Antworten (delta cpm) in Mäusen mit verschiedenen Haupthistokompatibilitäts (MHC)-Haplotypen, B6C3 F1 (C57B1/6xC³H/HcJ)-Mäusen (Fig. 2 und 4) und (A. S WxBALB/c F1-Mäusen (Fig. 3 und 5), für alle synthetischen Peptide. Die Werte des ³H-TdR-Einbaus stellen den Unterschied zwischen den Radioaktivitätswerten, die in Vertiefungen erhalten wurden, die Antigen enthielten, und in Kontrollvertiefungen ohne zugesetztes Antigen dar. Die unspezifische Proliferation von PLN-Zellen wurde durch Einschließen eines nichtverwandten Peptids in den Assays bestimmt, wie als ein horizontaler Balken für jedes Peptid gezeigt.

Alle einem Assay unterzogenen Peptide zeigten gute T-Zell-proliferative Antworten in B6C3 F1-Mäusen, während alle mittels Assay untersuchten Peptide, mit Ausnahme von Peptiden 105, 107, 109 und 111, gute T-Zell-proliferative Antworten in A. SWxBALB/c F1-Mäusen zeigten.

Es wurde durch die vorangehenden Ergebnisse und jene in BEISPIEL 2 beschriebenen gezeigt, daß Peptide 61, 63, 103, 104 und 113 nicht eine Anti-Peptid- Antikörpererzeugung stimulieren, aber sehr gute Immunogene sind, in ihrer Disulfid-(di-Cys)-Polymerform zum Hervorrufen einer starken T-Zell-Antwort, die gegen sowohl das entsprechende Peptid als auch das native HIV-Hüllprotein gp160 gerichtet ist.

Die T-Zell-Proliferation, die durch ³H-TdR-Einbau gemessen wurde, wurde ebenfalls auf ähnliche Weise mittels Assay untersucht als eine Funktion der T-Zell- Antigenkonzentration, unter Verwendung variiender Mengen an nativem gp120 oder gp160 als eine Kontrolle und PPD als eine andere Kontrolle. PLN aus B6C3 F1-Mäusen wurden in diesen Studien verwendet. Die Ergebnisse für Peptide 104 und 105 versus gp120 sind in den Fig. 6A bzw. 6B gezeigt; jene für Peptide 61 und 63 versus gp160 sind in den Fig. 7A bzw. 7B gezeigt; und jene für Peptide 65 und 111 versus gp120 sind in den Fig. 8A bzw. 8B gezeigt.

BEISPIEL 4 - Induktion von HIV-spezifischen cytotoxischen T-Lymphozyten

Gruppen von 3 bis 5 syngenischen weiblichen Mäusen (6 bis 8 Wochen alt) werden durch intradermale Injektion in eine geeignete Stelle mit einer wäßrigen Zusammensetzung immunisiert, die eine immunisierende (CTL-stimulierende) Menge an Peptid, entweder als Monomer oder als eines der zuvor diskutierten Multimere in CFA (1 : 1) enthielt. Zehn (10) Tage nach der Immunisierung werden ableitende PLN-Zellen und Milzlymphozyten erhalten und in vitro durch Kultivieren für sechs (6) Tage mit bestrahlten syngenischen normalen Milzzellen restimuliert, die mit dem gleichen synthetischen Peptid als Immunogen vorbehandelt worden waren.

Das Vorliegen von cytotoxischen T-Lymphozyten (CTL) wird durch einen 4- stündigen &sup5;¹Cr-Freisetzungsassay wie folgt bestimmt. Die PLN-Zellen werden für fünf Tage bei 37ºC in Click-Medium gehalten, das 10% fötales Kalbserum (FCS) zusammen mit bestrahlten syngenischen normalen Milzzellen enthielt, die mit dem geeigneten Testpeptid vorbehandelt waren. Diese Zellen wurden als die Effektorzellen bezeichnet und exprimieren das H-2d-MHC Klasse I-Antigen.

Zielzellen (Phytohämagglutinin-stimulierte (PHA)-Blasten von syngenischen Milzzellen der Maus oder P815-Mauszellen, die das entsprechende HIV-Protein exprimieren) wurden dreimal mit serumfreiem RPMI 1640-Medium gewaschen und dann gemischt, kontaktiert und gehalten (inkubiert) bei 37ºC für ungefähr 1,5 bis ungefähr 2 Stunden zusammen mit 250 uCi Natriumchromat (spezifische Aktivität 200-400 Ci/g &sup5;¹Cr, New England Nuclear, Boston, MA). Die Zielzellen werden anschließend mit RPMI 1640-Medium gewaschen, das 10% FCS enthält und in RPMI 1640 mit 10% FCS und verschiedenen Konzentrationen an Peptid resuspendiert. Diese Zellen werden dann dreimal mit RPMI gewaschen, das 10% FCS enthält, und auf 5 · 10&sup4; Zellen/ml resuspendiert. Ein Aliquot von 100 ul jeder Zellsuspension wird in eine Vertiefung einer Mikrotiterplatte mit 96 Vertiefungen, die einen U-förmigen Boden besitzen, zugegeben.

Ein 100 ul umfassendes Aliquot der geeigneten Effektorzellsuspension (5 · 10&sup6; Zellen/ml) wird jeder Vertiefung zugegeben, gefolgt von einer zweifachen Reihenverdünnung unter Erhalt verschiedener Verhältnisse von Effektor-zu- Zielzellen (E : T). Kontrollvertiefungen erhalten 0,1 ml RPMI-Medium mit 10% FCS allein in Abwesenheit von Effektorzellen, um einen Wert für die spontane Freisetzung von &sup5;¹Cr zu erhalten, und erhalten 0,1 ml 5% Triton X-100-Detergens, um einen Wert für die maximale Freisetzung von &sup5;¹Cr zu erhalten.

Die Platten werden bei 37ºC für ungefähr 4 Stunden inkubiert, worauf anschließend 100 ul Überstand von jeder Vertiefung in einem Gamma-Zähler verfolgt werden, um die Freisetzung von &sup5;¹Cr zu bestimmen. Der Prozentsatz an Cytotoxizität wird berechnet als

BEISPIEL 5 - Schneller Assay von HIV-spezifischen CTLs, die durch ein immundominantes Peptid induziert wurden

Ein Peptid mit der Sequenz RIQRGPGRAFVTIGK, nachfolgend als R15K (seq id no: 1) bezeichnet, aus dem immundominanten V3-Loop von HIV-gp160 ist zuvor als ein CTL-immundominantes Epitop in H-2d-Mäusen identifiziert worden (Takahashi et al., 1988). In den ursprünglichen Studien wurde gezeigt, daß CTLs, die in vivo durch Infizieren von BALB/c-Mäusen mit rekombinanten Vakziniavirus, der HIV-env-Proteine exprimierte, induziert wurden, syngenische Zielzellen lysieren, die mit R15K prä-inkubiert waren. Unglücklicherweise ist bis heute das Immunisieren von Mäusen mit freiem R15K-Peptid bei der Induzierung von CTLs ohne Erfolg gewesen (Berzofsky, 1991).

Demgemäß haben die vorliegenden Erfinder versucht, die Induktion von CD8&spplus;- HIV-R15K-spezifischen CTLs in 6-8 Wochen alten BALB/c-Mäusen zu untersuchen durch Einsetzen verschiedener Stellen der Inoculation, verschiedener Formen des Peptids und Wiedergewinnen der Effektorzellen aus Geweben verschiedener Herkunft. Es wurde beobachtet, daß ableitende popliteale Lymphknoten (PLN) von Mäusen, die mit 100 ug des R15K-Peptids (seq id no: 1) in einer 1 : 1-Emulsion mit CFA in das hintere Fußkissen immunisiert worden waren, die beste Quelle für CTL-Effektoren gegen bestrahlte (3300 Rad) syngenische Zielzellen waren, die mit monomeren R15K (40 ug/ml für 2 h bei 37ºC) vorinkubiert worden waren. Dies hat besonderes Gewicht und physiologische Bedeutung, da menschliche Lymphknoten als die primäre Stelle der Replikation von HIV beschrieben worden sind (Kaneshima et al., 1991; Fauci, 1991). Ein wichtiger Aspekt dieses Immunisierungsprotokolls ist, daß CTLs durch eine milde Homogenisierung von PLN wiedergewonnen werden konnten, die auf chirurgische Weise nach nur 10 Tagen entfernt worden waren.

Um die optimale Form des Peptids für eine einheitliche Induktion von Peptidspezifischen CTLs in vivo zu bestimmen, wurde das R15K-Peptid (seq id no: 1) in drei verschiedenen Konfigurationen hergestellt: (a) lineares Monomer, (b) Disulfid-verknüpftes Polymer, gebildet durch Oxidation von Cysteinresten, die sowohl am N- als auch C-Terminus hinzugefügt worden waren, und (c) Mizellen, gebildet durch Konjugieren des Peptids an Dipalmityl-lysin-glycin-glycin am N-Terminus (Hopp, 1984; Sastry und Arlinghaus, 1991). Es wurde festgestellt, daß eine einzelne Immunisierung von BALB/c-Mäusen in ein hinteres Fußkissen mit einer beliebigen der genannten R15K-Formen in CFA auf einheitliche Weise in der Bildung von CTLs resultierte, die auf spezifische Weise Zielzellen mit passendem MHC (P815, H-2d) lysieren, die mit dem Peptid prä-inkubiert worden waren. Derartige Antworten wurden in 8 von 12 Mäusen beobachtet, die mit der monomeren Form immunisiert waren, in 13 von 13 Mäusen, die mit der Mizellenform immunisiert worden waren, und in 6 von 8 Mäusen, die mit der Disulfidpolymerform des Peptids immunisiert worden waren. Eine Lyse von Zielzellen mit passendem MHC ohne eine Vorbehandlung mit Peptid (P815) wurde nicht beobachtet. Repräsentative Ergebnisse sind Fig. 9 gezeigt.

Die CTLs, die durch alle drei Formen des Peptids induziert wurden, lysierten ebenfalls auf spezifische Weise P815-Zellen, die mit einem rekombinanten Vakziniavirus infiziert worden waren, der HIV-gp160 (VPE16) exprimierte, nicht aber Zellen, die mit einem Kontroll-Vakziniavirus (P815+VSC8) infiziert waren (Fig. 10). Ein Western Blot-Experiment mit HIV-Antikörperpositiven menschlichen Seren bestätigte das Vorliegen von gp160-Protein in VPE16- infizierten, aber nicht in VSC8-infizierten P815-Zielzellen. Die Peptid-induzierten CTLs in BALB/c-Mäusen waren auf H-2 beschränkt ("H-2 restricted"). Sie lysierten nur mit Peptid-vorbehandelte H-2d-Zielzellen (P815), aber nicht Peptidbehandelte 3A9-Zielzellen, die den H-2K-Haplotyp exprimieren (TABELLE 7).

Repräsentative Ergebnisse mit CTLs, die in Mäusen gebildet wurden, die mit der Mizellenform von R15K (seq id no: 1)-Peptid immunisiert worden waren, sind in TABELLE 7 gezeigt. Ähnliche Ergebnisse wurden mit CTLs erhalten, die durch eine Injektion der monomeren und polymeren Formen des R15K-Peptids induziert worden waren.

Es wurden Experimente durchgeführt, um zu bestimmen, ob die Virusspezifischen CTLs CD8&spplus; oder CD4&spplus; waren. Eine Behandlung der CTL-Effektoren von Mäusen, die mit dem monomeren Peptid immunisiert worden waren, mit monoklonalen Anti-CD8-Antikörpern (MAbs) und Complement aus Kaninchen hob die Cytotoxität gegen Peptid-behandelte oder env-exprimierende Ziele auf (Fig. 11A). Im Gegensatz dazu hatte eine Vorbehandlung von Effektorzellen mit Anti-CD4-MAbs plus Complement oder Complement alleine keine bedeutende Wirkung. Ähnliche Ergebnisse wurden ebenfalls mit CTLs erhalten, die in Mäusen gebildet worden waren, die mit dem Peptid in Mizellenform (Fig. 11B) und polymeren Formen immunisiert worden waren. Die Induktion von CD8&spplus;-CTLs durch R15K (seq id no: 1) ist in Übereinstimmung mit der Verwendung von P815-Zielzellen, die MHC-Klasse I, aber nicht Klasse II-Genprodukte exprimieren (Maryanski et al., 1985). Eine MHC Klasse 1-Restriktion wird gemeinhin mit CD8&spplus;-Effektor-CTLs beobachtet.

Da das CTL-Epitop, das bei der vorliegenden Untersuchung studiert wurde, sich in der Mitte einer immundominanten B-Zell-aktiven Region von HIV-gp120 befindet, wurde die B-Zell-Aktivität des R15K-Peptids untersucht. Sowohl als Monomer oder mit einem Lipidschwanz versehene Mizelle oder nach einer Konjugation an KLH war dieses Peptid nicht in der Lage, in Mäusen einen meßbaren Titer an Anti-Peptid-Antikörper zu induzieren. Die Mäuse jedoch, die mit dem Peptid immunisiert worden waren, das an KLH konjugiert war, erzeugten Antikörper gegen KLH, was zeigt, daß die Mäuse immunkompetent waren. Seren von Mäusen, die in das Fußkissen immunisiert wurden, wurden ebenfalls getestet, wenn beobachtet wurde, daß keine Anti-Peptid-Antikörper gebildet worden waren.

TABELLE 7 Peptid- und Zielzellen-Spezifität von CTLs induziert in BALB/c-Mäusen durch das R15K-Peptid (seq id no: 1) des V3-Loops von HIV-env

a = Verhältnis von Effektor zu Zielzelle

b = Zielzellen mit passendem MHC (H-2d)

c = H-2d-Zellen, vorbehandelt mit dem R15K-Peptid des V3-Loops von HIV- env

d = H-2d-Zellen, vorbehandelt mit einem Influenzavirus-Peptid

e = H-2d-Zellen, vorbehandelt mit einem Sendaivirus-Peptid

f = Zielzellen mit nichtpassendem MHC (H-2k)

g = H-2k-Zielzellen, vorbehandelt mit HIV-env-Peptid V3-Loop

Trotz der zuvor dargestellten Ergebnisse konnte die Lage von R15K in einer variablen Region (V3-Loop/Schleife) von HIV-gp160 als ein Grund gesehen werden, nicht dieses Peptid als einen potentialen Kandidaten für eine Vakzine auszuwählen. Ein Vergleich der Aminosäuresequenzen von gp160 von 245 verschiedenen HIV-Isolaten hat jedoch gezeigt, daß nur so wenig wie fünf verschiedene Konsensussequenzen auf einer serologischen Basis unter all den viralen Isolaten definiert werden können (LaRosa et al., 1990). Deshalb schlagen die Erfinder vor, daß ein Gemisch von CTL-induzierrenden Peptiden aus V3-Loop-Regionen, die alle die Haupt-HIV-Gruppen (die fünf oder weniger sein können) umfassen, ausreichend sein kann für das Bilden von CTLs, die spezifisch für Zellen sind, die gp120 von den meisten, wenn nicht allen HIV-Stämmen exprimieren. Ein derartiges Gemisch würde dann als ein Prototyp einer Vakzine für die Bewertung zur Verhinderung einer HIV-Infektion von Menschen dienen.

BEISPIEL 6 - Beispiel von Virus-spezifischen CTL-Antworten durch T- Helferzell-induzierende Peptide

Das vorliegende Beispiel betrifft ein Verfahren zum Verstärken der systemischen Verteilung, des Aktivitätsniveaus und der Langlebigkeit von Virus-spezifischen CTLs, die in Antwort auf CTL-Epitop-tragende Peptide induziert wurden. Dieses Verfahren beinhaltet die Zugabe einer getrennten und verschiedenen Klasse von Peptiden zu dem Immunisierungsgemisch, das eine T-Helferzell-Aktivität besitzt, als ein Mittel zum Verstärken des CTL-induzierenden Vermögens eines gegebenen Peptidimmunogens.

Das Verfahren der Erfinder zum Induzieren von CTL-Antworten gegen Peptidimmunogene, wie in BEISPIEL 5 beschrieben, resultiert in einer schnellen CTL- Induktion in dem proximalen Lymphknoten (nahe der Stelle der Injektion). Es wurde jedoch beobachtet, daß entferntes lymphoides Gewebe (d. h. Milz) ein geringeres Maß an Antigen-spezifischen CTLs ansammelte. Als nächstes zogen die Erfinder den Schluß, daß die weitere Induktion einer T-Helferzell-Aktivität bei der Verbesserung der Verbreitung von spezifischen CTLs vorteilhaft sein kann. Da das zuvor beschriebene Verfahren das Durchmustern von CTL-induzierenden Peptiden erlaubt, ohne die Notwendigkeit, T-Helferzell-Epitopsequenz zu enthalten, testeten die Erfinder, ob HIV-T-Zell-Helfer-Peptide, auf physikalische Weise mit dem HIV-spezifischen CTL-induzierenden Peptid (RIQRGPGRAFVTIGK, R15K, seq id no: 1) gemischt, die beobachtete CTL-Antwort in Mäusen in Anschluß an mehrfache subkutane (sc) Injektionen verstärken würden. Das T-Helfer- Peptid, das für diese Studien ausgewählt wurde, war CRIKQIINMWQGVG- KAMYA, C19A (seq id no: 2), von dem zuvor gezeigt worden war, daß es eine T- Helferzell-induzierende Aktivität besitzt.

BALB/c-Mäuse wurden dreimal sc in zweiwöchentlichen Intervallen mit R15K- (seq id no: 1) Peptid injiziert, das mit dem T-Helfer-Peptid vermischt war, das in einer der drei Formen hergestellt worden war: Monomer, mit einem Peptidschwanz versehen, und Disulfidpolymer. Eine Woche nach der letzten Injektion wurden Milzzellen erhalten, restimuliert und auf ihre CTL-Aktivität getestet. Dieses Experiment war erfolgreich und es wurde eine bedeutende CTL-Aktivität in allen Mäusen beobachtet (TABELLE 8). Dieses Experiment wurde anschließend wiederholt durch Injizieren von Mäusen so mit einem Gemisch von R15K und der monomeren Form des T-Helfer-Peptids. In diesem Experiment wurden Milzzellen einem Assay auf eine HIV-spezifische CTL-Antwort nach einer, zwei und drei sc- Injektionen unterzogen und es wurde ein geringeres, aber bedeutendes Maß an positiven CTL-Antworten beobachtet (TABELLE 9).

TABELLE 8 CTL-Aktivität von Milzzellen von BALB/c-Mäusen, immunisiert subkutan (sc) mit einem Gemisch von R15K (seq id no: 1) und dem T-Helferzell-Peptid C19A (seq id no: 2)

a = Verhältnisse zu Effektor- zu Zielzellen

b = T-Helferzell-Peptid in seiner monomeren Form, gemischt mit R15K

c = T-Helferzell-Peptid in seiner polymeren Form, gemischt mit R15K

d = T-Helferzell-Peptid in seiner mit einem Peptidschwanz versehenen Form, gemischt mit R15K

e = Zielzellen mit passendem MHC (P815, H-2d)

f = P815-Zielzellen, prä-inkubiert mit R15K

g = P815-Zielzellen, prä-inkubiert mit der monomeren Form eines T-Helferzell- Peptids.

Mäuse wurden mit dem Peptidgemisch, emulgiert in vollständigem Freundschen Adjuvans (1 : 1) subkutan immunisiert in zweiwöchentlichen Intervallen für sechs Wochen (insgesamt drei Injektionen). Die Milz wurde eine Woche nach der letzten Injektion geerntet und für 5 Tage restimuliert, wie durch Sastry et al., 1992 beschrieben. Das Peptid 122 ist ein T-Helferzell-stimulierendes Peptid, das die Sequenz CRIKQIINMWQGVGKAMYA besitzt, ebenfalls hierin auch als C19A (seq id no: 2) bezeichnet; R15K ist ein CTL-induzierendes Peptid, das die Sequenz RIQRGPGRAFVTIGK (seq id no: 1) besitzt. Beide Sequenzen stammen von der gp120-Sequenz von HIV-1 (Sastry et al., 1991; 1992).

TABELLE 9 CTL-Aktivität von Milzzellen von BALB/c-Mäusen, immunisiert subkutan (sc) mit einem Gemisch von R15K (seq id no: 1) und dem T-Helferzell-Peptid C19A (seq id no: 2)

a = Verhältnisse von Effektor- zu Zielzellen

b = Mäuse wurden entweder einmal, zweimal oder dreimal mit einem Gemisch von R1 SK und der monomeren Form des T-Helferzell-Peptids immunisiert

c = Zielzellen mit passendem MHC (P815, H-sd)

d = P815-Zielzellen, prä-inkubiert mit R1 SK

e = P815-Zielzellen, prä-inkubiert mit der monomeren Form des T-Helferzell- Peptids.

Mäuse wurden subkutan mit dem Peptidgemisch, emulgiert in CFA (1 : 1) in Zweiwochen-Intervallen immunisiert. Eine Woche nach jeder Injektion wurden Milzzellen geerntet und wie durch Sastry et al., 1992, beschrieben, restimuliert.

Bis heute ist von keiner anderen Gruppe gezeigt worden, daß das R15K-Peptid selbst in der Lage ist, eine CTL-Antwort zu induzieren. Die vorliegenden Erfinder haben jedoch, wie hierin offenbart, eine CTL-Induktion in dem poplitealen Lymphknoten innerhalb von 7 Tagen durch eine einzelne id-Immunisierung von BALB/c-Mäusen mit R15K allein gezeigt (Fig. 12A). Es wurde deswegen der Schluß gezogen, daß ein Gemisch, bestehend aus R15K und dem T-Helfer-Peptid, wenn es einmal durch die id-Route injiziert wurde, ausreichend sein kann, um eine systemische Ausbreitung und Langlebigkeit einer HIV-spezifischen CTL-Antwort zu erzielen.

Eine Anzahl von Mäusen wurde mit einer einzelnen id-Injektion in die Fußkissen mit entweder dem CTL-Peptid R15K allein oder in einem Gemisch mit dem T- Helfer-Peptid C 19A (seq id no: 2) immunisiert. Die Ergebnisse (Fig. 12) zeigten, daß Mäuse, die mit dem Gemisch immunisiert worden waren, wesentlich höhere CTL-Antworten in der Milz besaßen als Mäuse, die einfach das R15K-Peptid allein erhielten (Fig. 12B). Weiterhin wurde der hohe Wert der CTL-Antwort in der Milz für bis zu acht Wochen nach einer einzelnen id-Injektion aufrecht erhalten, während das T-Helferzell-Peptid (C19A, seq id no: 2), das mitinjiziert wurde, keine CTL-induzierende Aktivität besaß.

Lasarte et al. (1992) berichteten kürzlich, daß mehrfache intraperitoneale Injektionen von Gemischen eines R15K-tragenden CTL-Epitops und eines T-Helferzell- Epitops, KQUIINMWQEVGKAMYA, in Mäuse nach drei Wochen eine HIV- spezifische CTL-Antwort auf niedrigem Wert induzierte. In diesen Experimenten war das CTL-Peptid selbst sogar nach mehreren Injektionen nicht in der Lage, HIV-spezifische CTLs zu induzieren. Deshalb ist die Rolle des T-Helfer-Peptids in diesen Studien nicht klar. Andererseits zeigen die zuvor beschriebenen Studien. daß das CTL-Peptid ein CTL-induzierendes Vermögen besitzt und die Rolle des T-Helfer-Peptids ist, diese inhärente CTL-Antwort des CTL-Peptids zu verbreiten und zu verstärken. Diese Studien zeigen deshalb, daß um eine wirksame, systemische und lang andauernde Zell-vermittelte Immunität zu erzeugen, der Kandidat für eine Vakzine-Zubereitung idealerweise sowohl T-Helfer- als auch CTL- Peptide enthalten sollte. Ein anderer wichtiger Aspekt dieser Erfindung ist, daß ein derartiges Gemisch, das einmal intradermal gegeben wird, ausreicht, eine andauernde systemische Antigen-spezifische CTL-Antwort zu induzieren.

BEISPIEL 7 - Schnelle Induktion von Influenzavirus- und Sendaivirusspezifischen CTLs

Es wurde angenommen, daß das Protokoll, das wie vorstehend in BEISPIEL 5 beschrieben ist, für die Induktion von HIV-spezifischen CTLs entwickelt wurde, auf die Identifizierung, Auswahl und den Assay eines beliebigen Peptids mit unbekannter Epitopspezifität auf seine Fähigkeit CTLs in vivo zu primen, allgemein anwendbar ist. Dementsprechend wurde die Peptid-Induktion von CTLs, die spezifisch für Influenzavirus sind, in vivo untersucht. Deres et al., (1989) hatten zuvor gezeigt, daß ein synthetisches Peptid R&supmin;, TYQRTRALVTG (As. 147-158), das einem Anteil des Nukleoproteins von Influenzavirus entspricht, Influenzavirusspezifische CTLs in Mäusen nur in vivo primen konnte, wenn es kovalent über den N-Terminus an Tripalmitoyl-S-Glycerylcysteinyl-Seryl-Serin (P&sub3;CSS) gebunden ist. Unter Verwendung des zuvor beschriebenen Protokolls konnten spezifi sche CD8&spplus;-CTLs, die Zielzellen lysierten, die mit diesem Peptid vorbehandelt waren, jedoch in vivo durch eine Immunisierung mit dem freien synthetischen Peptid (TABELLE 10) induziert werden.

Unter Einsatz dieses Immunisierungsprotokolls wurde eine CTL-Antwort in vivo ebenfalls erfolgreich gegen das unmodifizierte freie synthetische Peptid, HGEFAPGNYPALWSYA, gebildet, das das immundominante CTL-Epitop des Nukleoproteins von Sendaivirus darstellt (B105: NP 321-336).

Es wurde somit tatsächlich festgestellt, daß dieses Verfahren in Systemen, die nicht mit dem HIV-Virus verwandt sind, nützlich ist. Darüber hinaus wird davon ausgegangen, daß dieses schnelle Screening-Verfahren eine medizinische Nützlichkeit für das Entwickeln von Kandidaten-Vakzinen und -Therapeutika für verschiedene Infektionskrankheiten besitzen wird.

TABELLE 10 In vivo-Primen von Peptid-spezifischen CTLs in BALB/c-Mäusen mit einem freien synthetischen Peptid (B106) aus dem Influenzavirus-Nukleoprotein

ND = nicht durchgeführt

a = E : T = Verhältnis Effektor- zu Zielzelle

b = Zielzellen mit passendem MHC (H-2d)

c = H-2d-Zielzellen, vorbehandelt mit Influenzavirus-Peptid

d = H-2d-Zielzellen, vorbehandelt mit Sendaivirus-Peptid

e = Zielzellen mit nichtpassendem MHC (H-2k)

f = H-2k-Zielzellen, vorbehandelt mit Influenzavirus-Peptid

BEISPIEL 8 - Inhibierung einer HIV-1-Infektion und Bildung von Syncytien durch menschliche Zellen durch synthetische Peptide von gp120

Das vorliegende Beispiel beschreibt die Identifizierung und Verwendung von synthetischen Peptiden, die von gp 120 stammen, zum Schützen von menschlichen Zellen gegen eine HIV-1-Infektion, und zum Inhibieren der Bildung von Syncytien. MT-4-Zellen sind menschliche T-Zellen, die auf chronische Weise durch den menschlichen T-Zell-Leukämievirus Typ 1 infiziert sind, und eine lytische Infektion mit HIV-1 durchmachen (Larder et al., 1989). Deshalb wird eine Inhibierung einer HIV-1-Infektion von MT-4-Zellen den Zelltod verhindern.

Die Fähigkeit von gp120-abgeleiteten synthetischen Peptiden, eine HIV-Infektion von Zellen zu inhibieren, wurde untersucht. Es wurden Beweise erhalten zum Nachweis, daß synthetische Peptide variierender Länge (8-24 Aminosäuren), die aus dem V3-Loop von gp120 ausgewählt waren, eine HIV-Infektion von sowohl kultivierten menschlichen T-Zellen (Fig. 13, 14 & 15) als auch von frisch hergestellten primären menschlichen T-Zellen (Fig. 16) inhibierte.

Es wurde beobachtet, daß sowohl das 24 Aminosäuren umfassende Peptid N24G (As. 308-311, NNTRKSIRIQRGPGRAFVTIGKIG, seq id no: 3) als auch das 15 Aminosäuren umfassende Peptid R15K (As. 315-329, RIQRGPGRAFVTIGK, seq id no: 1) mit Sequenzen, die aus dem V3-Loop von HIV-1 IIIB stammen, eine HIV-1-Infektion von primären menschlichen T-Zellen bei einer Konzentration von 1 ug/ml (etwa 0,4-0,6 uM) um 92% inhibierte (Fig. 16). Eine 8 Aminosäuren umfassende kürzere Form des V3-Loop-Peptids, R8K (As. 322-329, RAFVTIGK, seq id no: 5) zeigte ebenfalls eine 66%-ige Inhibierung einer HIV-1-Infektion von primären menschlichen T-Zellen bei einer Konzentration von 1 ug/ml (ungefähr 125 uM) (Fig. 16). Synthetische Peptide von V3-Loop-Regionen von heterologen Isolaten, HIV-1-mn (T13Q, TKGPGRVIYATGQ, seq id no: 6) und HIV-1rf (H13N, HIGPGRAFYTTKN, seq id no: 7) zeigten ebenfalls eine bedeutende Inhibierung (> 60%), jeweils bei einer Konzentration von 1 ug/ml (ungefähr 0,78 uM) von Zellen durch den Stamm IIIB (Fig. 16).

Es wurde ebenfalls festgestellt, daß eine Vielzahl anderer Peptide mit Sequenzen, die aus den V3-Loops anderer HIV-1-Stämme abgeleitet waren, eine bedeutende Aktivität in Hinsicht auf die Inhibierung einer Infektion von menschlichen Zellen durch HIV-1 IIIB zeigten. Wie in TABELLE 11A ausführlich dargestellt, umfassen diese Peptide D23, D24, D25, D26, D30, D35, D38, D39, D40 und D44, was eine Vielzahl von Stämmen widerspiegelt, wie mn, rf, wmj-3, sc, z6, eli, mn (y-1) und mn (y-p). Es ist jedoch wichtig festzustellen, daß dieser Assay auf spezifische Weise eingeschränkt ist auf die Inhibierung der Infektion des heterologen Stamms HIV-1 IIIB. Deshalb können Peptide wie solche in TABELLE 11B, die keine Aktivität in diesem spezifischen Assay zeigen, dennoch eine Nützlichkeit als Infektions-inhibierende Sequenzen zum Bekämpfen der Vielzahl von HIV-Stämmen, die bekanntermaßen in der infizierten menschlichen Population vorliegen, sein.

TABELLE 11A Wirkung von V3-Loop-Peptiden auf eine HIV-1 IIIB-Infektion von menschlichen Zellen
TABELLE 11B Wirkung von V3-Loop-Peptiden auf eine HIV-1 IIIB-Infektion von menschlichen Zellen

Das Vermögen des Peptids E13V, EQLWVTVYYGVPV (seq id no: 4) aus dem Amino-terminalen Teil von gp120, eine HIV-1-Infektion von primären menschlichen T-Zellen zu inhibieren, wurde ebenfalls bestimmt. Es wurde beobachtet, daß dieses Peptid, bei einer so geringen Konzentration wie 1 ng/ml (ungefähr 0,77 nM) die HIV-1-Infektion um 90% inhibierte (Fig. 18).

Es wurden weitere Studien durchgeführt, um die Wirkung von synthetischen V3- Loop-Peptiden von verschiedenen HIV-1-Stämmen auf die Bildung von Syncytium zu bestimmen. Für diese Studien wurden HeLa-CD4-Zellen mit rekombinan ten Vakziniaviren infiziert, die das Hüllprotein gp160 der HIV-1 IIIB-, mn-, oder rf-Stämme exprimierten, bei einer m. o. i. von 100, in Gegenwart oder Abwesenheit von V3-Loop-Peptiden aus den jeweiligen HIV-1-Stämmen (d. h. R15K, H13N und T13Q). 18 Stunden nach der Infektion wurden Zellen unter Verwendung einer Vergrößerung von 100 auf Syncytien unter dem Mikroskop beobachtet.

In diesen Studien wurden keine Syncytien in Zellen beobachtet, die vor Infektion mit den jeweiligen rekombinanten Vakziniaviren mit den synthetischen Peptiden inkubiert worden waren. Diese Ergebnisse zeigen deutlich die Fähigkeit von V3- Loop-Peptiden, eine Verbreitung von HIV-1 von Zelle zu Zelle zu inhibieren.

Es wurden Studien durchgeführt, um die Stabilität des R15K-Peptids von dem HIV-1 IIIB-Isolat in Serum zu untersuchen. In diesem Studien wurde das R15K- (seq id no: 1)-Peptid bei 37ºC in fötalem Kalbserum inkubiert, und während der Inkubation wurden zu verschiedenen Zeitintervallen Aliquots mit einer Endkonzentration von 1 ug/ml (ungefähr 0,6 uM) auf eine Inhibierung einer HIV-1- Infektion einer menschlichen T-Zellinie (MT-4-Zellen) getestet. Diese Ergebnisse sind in Fig. 17 gezeigt. Das R15K-Peptid behielt seine inhibitorische Aktivität in voller Stärke für bis zu vier Stunden bei und 50% der inhibitorischen Aktivität von unbehandeltem Kontrollpeptid wurde sogar nach 24 Stunden bei 37ºC in fötalem Kalbserum beibehalten.

Man stellt sich vor, daß Stabilitätsuntersuchungen für jedes beliebige synthetische Peptid oder deren Mischungen, die für eine potentielle klinische Verwendung identifiziert wurden, durchgeführt werden. Derartige Tests werden beispielsweise eine Vorinkubation in menschlichem Serum und Plasma; eine Behandlung mit verschiedenen Proteasen, und ebenfalls Temperatur- und pH-Stabilitäts-Analysen umfassen. Wenn es als nötig befunden wird, kann die Stabilität der synthetischen Peptide durch ein beliebiges einer Vielzahl von Verfahren erhöht werden, wie beispielsweise der Verwendung von d-Aminosäuren anstelle von 1-Aminosäuren zur Peptidsynthese; der Verwendung von Schutzgruppen von t-boc und derglei chen; oder dem Einkapseln der Peptide in Liposomen. Die Bioverfügbarkeit von ausgewählten Gemischen von Peptiden kann ebenfalls bestimmt werden, indem radioaktivmarkierte Peptide in Mäuse und Rhesusaffen injiziert und anschließend ihre Gewebeverteilung analysiert wird.

Zusätzlich zu dem vorangehenden Nachweis der Erfinder, daß das R15K-Peptid CTL-Antworten induzieren kann (siehe vorstehend BEISPIEL 5), zeigen sie weiterhin, daß dieses Peptid und seine Analoge von anderen HIV-1-Isolaten menschliche T-Zellen auf wirksame Weise vor einer HIV-1-Infektion schützt. Diese Aktivität wurde unter Verwendung von kultivierten Zellen wie H9-, CEM- und MT-4- Zellen und frisch hergestellten menschlichen T-Zellen gezeigt. Diese Ergebnisse deuten darauf hin, daß die V3-Loop-Peptide auf zwei getrennte Arten wirken können: 1) unter Induzieren von HIV-1-spezifischen cytotoxischen T-Lymphozyten, die auf wirksame Weise Zellen töten, die HIV-1-gp120 exprimieren; und 2) unter Verhinderung einer Infektion von normalen Zellen durch infektiöses Virus. So besitzen V3-Loop-Peptide eine Nützlichkeit nicht nur für Vakzinen, sondern auch als therapeutische Reagenzien zur Verhinderung einer HIV-1-Infektion beim Menschen oder zum Reduzieren des Verbreitens der Virusinfektion in HIV- infizierten Individuen.

BEISPIEL 9 - Induktion von HIV-spezifischen T-Zell-Antworten in Affen nach Immunisierung mit einem synthetischen Peptid-Cocktail

Das vorliegende Beispiel beschreibt die erfolgreiche Induktion von HIV- spezifischen T-Zell-Antworten in Rhesusaffen mit einem Gemisch von acht synthetischen Peptiden, wobei sieben davon aus konservierten Regionen des HIV-1- Hüllproteins stammen. Diese Ergebnisse, die eine Induktion von HIV-1- spezifischen T-Zell-Antworten in einem nichtmenschlichen Primatenmodell zeigen, stellen einen wichtigen Schritt vorwärts zur Identifizierung und Formulierung einer synthetischen Peptid-basierten Vakzine dar, die eine Zell-vermittelte Immunität mit breiter Basis zum Schützen von Menschen gegen eine HIV-Infektion induzieren kann.

In den vorliegenden Studien wurden drei Rhesusaffen (#7, #23 und #283C) subkutan mit 1 ml (0,1 ml/Stelle) eines Gemischs von acht synthetischen Peptiden (300 ug von jedem Peptid in sterilem Wasser), emulgiert in vollständigem Freundschen Adjuvans in einem Verhältnis von 1 : 1, immunisiert. Diese acht Peptide, genannt 61, 63, 104, 105, 111, 113, 116 und R15K (TABELLE 12) waren zuvor als gp160-spezifische T-Zell-aktive synthetische Peptide identifiziert worden. 3 und 7 Wochen nach der primären Immunisierung wurden zwei Auffrischinjektionen des Peptidgemischs (150 ug von jedem Peptid in sterilem Wasser), emulgiert in unvollständigem Freundschen Adjuvans, an jeden Affen gegeben. Der Affe #7 wurde nach 34 Wochen aus Gesundheitsgründen, die nicht mit dieser Studie zusammenhingen, getötet, während die beiden verbleibenden Affen (#283C und #23) eine zusätzliche Auffrischinjektion nach 25 Wochen erhielten.

TABELLE 12 Aminosäuresequenzen von immunisierenden Peptiden

Die Numerierung der Amino- und Carboxy-terminalen Aminosäuren jedes Peptids entspricht der durch Modrow et al., 1987 berichteten Sequenz.

In Zweiwochen-Intervallen nach der ersten Immunisierung jedes Tiers wurden 15 ml an heparinisiertem Gesamtblut durch Venenpunktion gesammelt. Die mononukleären Zellen aus dem peripheren Blut (peripheral blood mononuclear cells; PBMC) wurden durch übliche Ficoll-Hypaque-Zentrifiguation getrennt und in Proliferationsassays eingesetzt. Die PBMCs wurden alle zwei Wochen über einen Zeitraum von 32 Wochen auf proliferative Antworten gegen individuelle Peptide und rekombinantes gp160 verfolgt.

Es wurde festgestellt, daß PBMCs von allen drei Rhesusaffen gute proliferative Antworten mit den Peptiden 104 (As. 45-55), 111 (As. 118-130) und 63 (As. 519- 543) zeigten; während schwache Antworten mit den Peptiden 113 (As. 204-216) und 116 (As. 240-252) beobachtet wurden (TABELLE 13). Zwei dieser drei von Rhesusaffen stammenden PBMC-Zubereitungen zeigten ebenfalls gute proliferative Antworten mit Peptid 61 (As. 586-598) (TABELLE 13). In keinem der Affen wurde eine bedeutende Antwort mit den Peptiden 105 (As. 48-61) und R15K (As. 315-329) nachgewiesen. PBMCs aus allen drei Affen zeigten signifikant höhere proliferative Antworten mit rekombinantem gp160, dem HIV-1-Hüllprotein- Vorläufer, über die gesamte Zeitdauer des Experiments.

TABELLE 13 T-Zell-Proliferations-Antworten

(-) keine nachweisbare Antwort; (1+) schwache Antwort; (2+) gute Antwort, (3+) bessere Antwort; (4+, 6+) beste Antwort.

Diese Ergebnisse zeigen, daß Gemische von synthetischen Peptiden von dem HIV-env-Genprodukt gp160-spezifische T-Zell-Antworten in Rhesusaffen primen können. Wegen ihrer Fähigkeit, spezifische T-Zell-Antworten in sowohl Mäusen als auch Rhesusaffen zu induzieren, wird vorgeschlagen, daß diese HIV-env- Peptide als Komponenten von Vakzinen zur Verhinderung einer HIV-Infektion beim Menschen nützlich sind.

ZITIERTE DRUCKSCHRIFTEN

Die folgenden Druckschriften werden hierdurch mittels Bezugnahme aufgenommen in Hinsicht auf den Gegenstand, wie er in der Beschreibung ausgeführt ist und in dem Umfang, in dem sie eine Basis für verschiedene Aspekte der vorliegenden Erfindung offenbaren, lehren, ermöglichen oder bereitstellen.

Ahearne et al., III International Conference on AIDS in Washington, D. C., 1.-5. Juni, 1987, Abstract # M.10.3, S. 8

Aichele, P., Hengartner, H. Zinkernagel, R. M. & Schulz, M. J., Exp. Med. 171: 1815-1820 (1990)

Barnes, Science 236: 255 (1987)

Berzofsky et al., Nature 334: 706-708 (1988)

Berzofsky, J. A., FASEB J. 5: 2412-2418 (1991)

Bodansky et al., Peptide Synthesis, John Wiley and Sons, 2. Auflage (1976)

Buller et al., Nature, 328: 77 (1987)

Cease et al., Proc. Natl. Acad. Sci. USA, 84: 4249-4253 (1987)

Click et al., Cellular Immunol. 3: 264-276 (1972)

Coates et al., Nature, 326: 549 (1987)

Culmann et al., Eur. J. Immunol., 19: 2383 (1989)

Dadaglio et al., J. Immunol., 147: 2302 (1991)

De Lisi & Berzofsky, Proc. Natl. Acad. Sci. USA, 82: 7048 (1985)

Deres, K. Schild, H. Wiesmuller, K-H. Jung, G. & Rammensee, H-G., Nature 342: 561-564 (1989)

De Rossi et al., Virology 184: 187-196 (1991)

Doherty et al., Adv. Cancer Res., 42: 1 (1985)

Earl et al., Science, 234: 728 (1986)

Fathman, Ann. Rev. Immunol., 5: 477 (1987)

Fauci, A., AIDS Update 4: 103 (1991)

Freed & Risser, J. Virol. 61: 2852-2856, (1987)

Freed et al., Poc. Natl. Acad. Sci. USA 87: 4650-4654 (1990)

Gao et al., J. Immunol. 147: 3268-3273 (1991)

Hart et al.,Proc. Natl. Acad. Sci. USA 88: 9448-9452 (1991)

Ho et al., J. Virol., 61: 2024 (1987)

Hopp & Woods, J. Mol. Biol. 23: 807 (1982)

Hopp, T. P., Mol. Immunol. 21: 13-16 (1984)

Hosmalin et al., Proc. Natl. Acad. Sci., 87: 2344 (1990)

Houghten, Proc. Natl. Acad. Sci, USA, 82: 5131-5135 (1985)

Javaherian et al., Proc. Natl. Acad. Sci. U. S. A. 86: 6768-6772 (1989)

Johnson et al., J. Immunol., 147: 1512 (1991)

Johnson et al., J. Exp. Med., 175: 961-971 (1992)

Kaneshima, H. et al., Proc. Natl. Acad. Sci. U. S. A. 88: 4523-4527 (1991)

Kast, W. M. et al., Proc. Natl. Acad. Sci. U. S. A. 88: 2283-2287 (1991)

Koenig, S. et al., J. Immunol., 145: 127 (1990)

Koito et al., Int. Immunol. 1: 613-618 (1989)

Kyte & Doolittle, J. Mol. Biol., 157: 105-132 (1982)

Larder et al., Science, 243: 1731-1734 (1989)

LaRosa, G. J. et al., Science 249: 932-935 (1990)

Lasarte et al., Cell. Immunol. 141: 211-218 (1992)

Legrain et al., J. Virol., 60: 1141 (1986)

Linsley et al., J. Virol. 62: 3695-3702 (1988)

Livingston & Fathman, Ann. Rev. Immunol. 5: 477 (1987)

Maddon et al., Cell, 47: 333 (1986)

Maizel et al., Eur. J. Immunol. 10: 509 (1980)

Mannhalter et al., J. Immunol. 136: 2792-2799 (1986)

Maryanski, J. L. et al., Eur. J. Immunol. 15: 1111-1117 (1985)

McCune et al., Cell 53: 55-67 (1988)

McOmie, J. F. W., Protective Groups in Organic Chemistry, Plenum Press, New York, (1973).

Merrifield, J. An. Chem. Soc. 85: 2149-2154 (1963)

Michel et al., AIDS Research and Human Retrovirusus, 84: 469-478 (1992)

Milich and McLachlan, Science, 234: 1398, (1986)

Millich et al., J. Immunol. 134: 4194-4203 (1985)

Milich et al., J. Exp. Med. 164: 532 (1988)

Mittler, R. S. & Hoffman, M. K., Science 245: 1380-1382 (1989)

Modrow et al., J. Virol., 61: 570-578 (1987)

Murakami et al., Biochem. Biophys. Acta 1079: 279-284 (1991)

Naso et al., J. Virol., 45: 1200 (1983)

Nixon, D. F. et al., Nature 336: 484-487 (1988)

Platsoucas, C. D. & Good R., Proc. Natn. Acad. Sci. U. S. A. 78: 4500-4505 (1981)

Popovic et al., Science, 224: 497-500 (1984)

Rees, Nature, 326: 343 (1987)

Robey et al., Proc. Natl. Acad. Sci., USA 83: 7023 (1986)

Sastry, K. J. & Arlinghaus, R. B., AIDS, 5: 699-707 (1991)

Sastry et al., Virology, 188: 502-509 (1992)

Senyk et al., J. Exp. Med., 133: 1294 (1971)

Sette et al., Mol. Immunol., 23: 807 (1986)

Siliciano, R. F. et al., Cell, 54: 561-575 (1988)

Takahashi, H. et al., Proc. Natn. Acad. Sci. U. S. A., 85: 3105-3109 (1988)

Townsend, A. R. M. et al., Cell, 44: 959-968 (1986)

Travis et al., Virology, 186: 313-317 (1992)

Wain-Hobson et al., Cell, 40: 9 (1985)

Walker et al., Science, 234: 1563-1566 (1986)

Walker et al., Nature, 328: 345 (1987)

Walker et al., Proc. Natl. Acad. Sci., 86: 9514 (1989)

Weinhold, K. J, et al., J. Immunol. 142: 3091-3097 (1989)

SEQUENZPROTOKOLL

(1) ALLGEMEINE ANGABEN:

(i) ANMELDER: BOARD OF REGENTS, THE

UNIVERSITY OF TEXAS SYSTEM

(ii) ERFINDER: SASTRY, Jagannadha K.

ARLINGHAUS, Ralph B.

PLATSOUCAS, Chris D.

NEHETE, Pramod N.

(iii) BEZEICHNUNG DER ERFINDUNG: VERFAHREN UND ZUSAMMENSETZUNGEN ZUM HERVORRUFEN VON IMMUN- ODER ANTI-INFEKTIVEN ANTWORTEN

(iv) ANZAHL DER SEQUENZEN: 7

(v) BRIEFADRESSE:

(A) ADRESSAT: Arnold, White & Durkee

(B) STRASSE: P. O. Box 4433

(C) ORT: Houston

(D) BUNDESLAND: Texas

(E) LAND: US

(F) POSTLEITZAHL: 77210

(vi) COMPUTERLESBARE FASSUNG:

(A) DATENTRÄGER: Floppy Disk

(B) COMPUTER: IBM PC-kompatibel

(C) BETRIEBSSYSTEM: PC-DOS/MS-DOS

(D) SOFTWARE: WordPerfect 5.1

(vii) DATEN DER JETZIGEN ANMELDUNG

(A) ANMELDENUMMER: unbekannt

(B) ANMELDETAG: unbekannt

(C) KLASSIFIKATION: unbekannt

(viii) DATEN DER VORANMELDUNG:

(A) ANMELDENUMMER: 07/800, 932

(B) ANMELDETAG: 2. Dezember 1991

(C) KLASSIFIKATION: 424

(ix) DATEN DER VORANMELDUNG:

(G) ADRESSAT: Arnold, White & Durkee

(A) ANMELDENUMMER: 07/945 865

(B) ANMELDETAG: 16. September 1992

(C) KLASSIFIKATION: unbekannt

(x) ANGABEN ZUM VERTRETER

(A) NAME: Parker. David L.

(B) VERTRETERNUMMER: 32165

(C) AKTENZEICHEN: UTFC305PCT

(xi) TELEKOMMUNIKATION:

(A) TELEFON: 512-320-7200

(B) TELEFAX: 512-474-7577

(C) TELEX: nicht anwendbar

(2) Angaben zu SEQ ID NO: 1:

(i) Sequenzcharakteristika

(A) Länge: 15 Aminosäuren

(B) Art: Aminosäure

(C) Strangform: Einzelstrang

(D) Topologie: linear

(ii) Art des Moleküls: Peptid

(xi) Sequenzbeschreibung: SEQ ID NO: 1:

(3) Angaben zu SEQ ID NO: 2:

(i) Sequenzcharakteristika

(A) Länge: 19 Aminosäuren

(B) Art: Aminosäure

(C) Strangform: Einzelstrang

(D) Topologie: linear

(ii) Art des Moleküls: Peptid

(xi) Sequenzbeschreibung: SEQ ID NO: 2:

(4) Angaben zu SEQ ID NO: 3:

(i) Sequenzcharakteristika

(A) Länge: 24 Aminosäuren

(B) Art: Aminosäure

(C) Strangform: Einzelstrang

(D) Topologie: linear

(ii) Art des Moleküls: Peptid

(xi) Sequenzbeschreibung: SEQ ID NO: 3:

(5) Angaben zu SEQ ID NO: 4:

(i) Sequenzcharakteristika

(A) Länge: 13 Aminosäuren

(B) Art: Aminosäure

(C) Strangform: Einzelstrang

(D) Topologie: linear

(ii) Art des Moleküls: Peptid

(xi) Sequenzbeschreibung: SEQ ID NO: 4:

(5) Angaben zu SEQ ID NO: 5

(i) Sequenzcharakteristika

(A) Länge: 8 Aminosäuren

(B) Art: Aminosäure

(C) Strangform: Einzelstrang

(D) Topologie: linear

(ii) Art des Moleküls: Peptid

(xi) Sequenzbeschreibung: SEQ ID NO: 5:

(6) Angaben zu SEQ ID NO: 6:

(i) Sequenzcharakteristika

(A) Länge: 13 Aminosäuren

(B) Art: Aminosäure

(C) Strangform: Einzelstrang

(D) Topologie: linear

(ii) Art des Moleküls: Peptid

(xi) Sequenzbeschreibung: SEQ ID NO: 6:

(7) Angaben zu SEQ ID NO: 7:

(i) Sequenzcharakteristika

(A) Länge: 13 Aminosäuren

(B) Art: Aminosäure

(C) Strangform: Einzelstrang

(D) Topologie: linear

(ii) Art des Moleküls: Peptid

(xi) Sequenzbeschreibung: SEQ ID NO: 7:


Anspruch[de]

1. Zusammensetzung, umfassend ein erstes und ein zweites Peptid, wobei das erste Peptid ein CTL-induzierendes Epitop und das zweite Peptid eine HIV-Infektions-inhibierende Peptidsequenz umfaßt, die das Eindringen von HIV in eine Zielzelle inhibiert.

2. Zusammensetzung nach Anspruch 1, wobei das erste Peptid eine Sequenz umfaßt, die sowohl ein CTL-induzierendes Epitop als auch eine HIV-Infektions-inhibierende Peptidsequenz ist, die das Eindringen von HIV in eine Zielzelle inhibiert.

3. Zusammensetzung nach Anspruch 1 oder 2, weiterhin umfassend ein drittes Peptid, wobei das dritte Peptid ein CTL-Reaktions-verstärkendes T-Helferzell-induzierendes Epitop umfaßt.

4. Zusammensetzung nach Anspruch 3, wobei das CTL-Reaktions-verstärkende T- Helferzell-induzierende Epitop dadurch gekennzeichnet ist, daß es einen amphipatischen Wert von ungefähr + 10 bis ungefähr + 20 besitzt.

5. Zusammensetzung nach Anspruch 3 oder 4, wobei die Sequenz des ersten, zweiten oder dritten Peptids eine Sequenz umfaßt, die aus einem HIV-Genprodukt abgeleitet ist.

6. Zusammensetzung nach Anspruch 5, wobei die Sequenz des Peptids, das ein CTL- induzierendes Epitop umfaßt, eine Sequenz gemäß den in Tabelle 1 dargestellten umfaßt.

7. Zusammensetzung nach Anspruch 5, wobei die Sequenz des ersten, zweiten oder dritten Peptids eine Sequenz umfaßt, die von einem HIV-Hüll-Genprodukt abgeleitet ist.

8. Zusammensetzung nach Anspruch 7, wobei die Sequenz des ersten, zweiten oder dritten Peptids eine Sequenz umfaßt, die von HIV-gp120 abgeleitet ist.

9. Zusammensetzung nach Anspruch 8, wobei die Sequenz des Peptids, das ein CTL- induzierendes Epitop umfaßt, eine Sequenz umfaßt, die von dem V3-Loop von HIV- gp120 abgeleitet ist.

10. Zusammensetzung nach Anspruch 9, wobei die Sequenz des V3-Loop-abgeleiteten CTL-induzierenden Peptids eine Sequenz gemäß den in Tabelle 2 dargestellten umfaßt.

11. Zusammensetzung nach Anspruch 10, wobei die Sequenz des V3-Loop-abgeleiteten CTL-induzierenden Peptids die Sequenz RIQRGPGRAFVTIGK (R15K, SEQ ID NO: 1) umfaßt.

12. Zusammensetzung nach Anspruch 8, wobei die Sequenz des Peptids, das das CTL- Reaktions-verstärkende T-Helferzell-induzierende Epitop umfaßt, eine Sequenz umfaßt, die von einer HIV-gp120-Sequenz abgeleitet ist, die dadurch gekennzeichnet ist, daß sie einen amphipatischen Wert von ungefähr + 10 bis ungefähr + 20 besitzt.

13. Zusammensetzung nach Anspruch 12, wobei die Sequenz des CTL-Reaktionsverstärkenden T-Helferzell-induzierenden Peptids die Sequenz CRIKQIINMWQGVGKAMYA (C19A, SEQ ID NO: 2) umfaßt.

14. Zusammensetzung nach Anspruch 7, wobei das Peptid, das die HIV-Infektionsinhibierende Peptidsequenz umfaßt, eine Sequenz umfaßt bei der Antikörper gegen diese Sequenz in der Lage sind, eine zelluläre Infektion durch HIV zu inhibieren.

15. Zusammensetzung nach Anspruch 8, wobei die Sequenz des HIV-Infektionsinhibierenden Peptids eine Sequenz umfaßt, die von dem V3-Loop, dem N-terminalen Anteil oder der CD4-Bindungsregion von HIV-gp120 abgeleitet ist.

16. Zusammensetzung nach Anspruch 15, wobei die Sequenz des HIV-Infektionsinhibierenden Peptids eine Sequenz gemäß den in Tabelle 11 A dargestellten umfaßt.

17. Zusammensetzung nach Anspruch 15, wobei die Sequenz des HIV-Infektionsinhibierenden Peptids die Sequenz RIQRGPGRAFVTIGK (R15K, SEQ ID NO: 1), NNTRKSIRIQRGPGRAFVTIGKIG (N24 G, SEQ ID NO: 3), EQLWVTVYYGVPV (E13V, SEQ ID NO: 4), RAFVTIGK (RBK, SEQ ID NO: 5) TKGPGRVIYATGQ (T13Q, SEQ ID NO: 6), oder HIGPGRAFYTTKN (H13N, SEQ ID NO: 7) umfaßt.

18. Zusammensetzung nach Anspruch 17, wobei die Sequenz des HIV-Infektionsinhibierenden Peptids die Sequenz EQLWVTVYYGVPV (E13V, SEQ ID NO: 4) umfaßt.

19. Zusammensetzung nach Anspruch 1, wobei die Peptide Monomere, Polymere oder mit Lipid-Schwänzen versehene Peptide sind.

20. Zusammensetzung nach Anspruch 1, wobei die Peptide in einem pharmakologisch verträglichen Vehikel dispersiert sind.

21. Zusammensetzung nach Anspruch 1, wobei die Sequenz des ersten Peptids von einem Influenzavirusprotein oder einem Sendaivirusprotein abgeleitet ist.

22. Zusammensetzung nach Anspruch 21, wobei die Sequenz des Peptids die Sequenz TYQRTRALVTG oder HGEFAPGNYPALWSYA umfaßt.

23. Verwendung einer Zusammensetzung gemäß einem der Ansprüche 1 bis 22 bei der Herstellung eines Medikaments zum Hervorrufen einer Immunantwort in einem Säugetier.

24. Verwendung einer Zusammensetzung gemäß einem der Ansprüche 1 bis 22 bei der Herstellung eines Medikaments zur Inhibierung einer HIV-Infektion einer Zielzelle.

25. Verfahren zur Herstellung von zytotoxischen T-Zellen, die auf spezifische Weise gegen eine ausgewählte Zusammensetzung geprimt sind, wobei das Verfahren die folgenden Schritte umfaßt:

(a) Immunisieren eines Tiers mit der Zusammensetzung nach einem der Ansprüche 1-22, die zytotoxische T-Zellen primen kann; und

(b) Wiedergewinnen der zytotoxischen T-Zellen aus drainierenden Lymphknoten des immunisierten Tiers.







IPC
A Täglicher Lebensbedarf
B Arbeitsverfahren; Transportieren
C Chemie; Hüttenwesen
D Textilien; Papier
E Bauwesen; Erdbohren; Bergbau
F Maschinenbau; Beleuchtung; Heizung; Waffen; Sprengen
G Physik
H Elektrotechnik

Anmelder
Datum

Patentrecherche

Patent Zeichnungen (PDF)

Copyright © 2008 Patent-De Alle Rechte vorbehalten. eMail: info@patent-de.com