PatentDe  


Dokumentenidentifikation DE69527708T2 30.04.2003
EP-Veröffentlichungsnummer 0762895
Titel SYNTHETISCHER IMPFSTOFF ZUM SCHUTZ GEGEN INFEKTIONEN MIT DEM MENSCHLICHEN IMMUNSCHWÄCHEVIRUS
Anmelder Duke University, Durham, N.C., US
Erfinder HAYNES, Barton F., Durham, US;
PALKER, Thomas J., Durham, US
Vertreter Schwabe, Sandmair, Marx, 81677 München
DE-Aktenzeichen 69527708
Vertragsstaaten AT, BE, CH, DE, DK, ES, FR, GB, GR, IE, IT, LI, LU, MC, NL, PT, SE
Sprache des Dokument EN
EP-Anmeldetag 28.04.1995
EP-Aktenzeichen 959177973
WO-Anmeldetag 28.04.1995
PCT-Aktenzeichen PCT/US95/05465
WO-Veröffentlichungsnummer 0009529700
WO-Veröffentlichungsdatum 09.11.1995
EP-Offenlegungsdatum 19.03.1997
EP date of grant 07.08.2002
Veröffentlichungstag im Patentblatt 30.04.2003
IPC-Hauptklasse A61K 39/21
IPC-Nebenklasse C07K 14/155   C07K 17/02   C07K 19/00   

Beschreibung[de]

Die vorliegende Erfindung betrifft Peptide, die zur Impfung gegen AIDS verwendet werden können, einschließlich Peptide, umfassend eine Aminosäuresequenz, entsprechend einer Domäne des menschlichen Hüllenproteins des Immunschwächevirus (HIV), gegen den neutralisierende Antikörper erzeugt werden. Die Erfindung betrifft weiterhin einen Impfstoff, der ein Peptid umfasst, das entweder direkt oder über ein Abstandsmolekül an ein Trägermolekül gebunden ist, und sich für die Impfung von Menschen eignet.

Hintergrundinformation

Es wurde nachgewiesen, dass der menschliche Retrovirus HIV der ursächliche Auslöser für das Immunschwächesyndrom (AIDS) ist, für eine Krankheit, für die es gegenwärtig keine Heilung gibt. Das epidemiologische Muster bei Fällen mit AIDS Bezug zeigt, dass es eine übertragbare Krankheit ist. Der Virus wird häufig im Speichel, Sperma, Gesamtblut und Plasma von Personen in Gruppen mit hohem Risiko angetroffen, einschließlich männlichen Homosexuellen, intravenösen Drogenbenutzern. Personen, die Blutprodukte erhalten, und Personen aus Haiti und Zentralafrika. Die schnelle Zunahme der Seropositivität unter Personen von Gruppen mit hohem Risiko, die Virulenz der Krankheit und ihre rasche weltweite Ausbreitung unterstreichen das überwältigende und sofortige Bedürfnis nach einem Impfstoff, der in der Lage ist, nicht infizierten Personen einen vollständigen Immunschutz zu verleihen. Der Bedarf an diagnostischen Reagenzien für die Verwendung zur Prüfung auf das Vorliegen von Antikörpern gegen HIV in biologischen Proben ist ebenfalls offensichtlich.

Frühere Arbeiten haben gezeigt, dass der HIV die T-Lymphozyten des Immunsystems durch Anlagerung seines äußeren Hüllenglycoproteins (gp120) an das CD4 (T4)-Molekül auf der Oberfläche von T-Lymphozyten infiziert, indem er das CD4 (T4)-Molekül als Rezeptor zum Eindringen und zur Infizierung der T-Zellen benützt. Nach InJizierung der Zelle untergräbt der Virus die Fähigkeit der T-Zelle den Virus abzuwehren.

Es wurde gezeigt, dass retrovirale Hüllenglycoproteine bei der Auslösung einer virusneutralisierenden Antikörperreaktion wichtig sind, die durch die Fähigkeit von Seren bestimmt wird, die anti-Hüllen Antikörper enthaltenden HIV-Infektionen in vitro zu inhibieren. Es wurde insbesondere gezeigt, dass das externe HIV-Hüllenglycoprotein gp120 in der Lage ist, neutralisierende Antikörper in Ziegen und Menschen zu inhibieren (Robey et al., Proc. Natl. Acad. Sci. (USA), 83: 7023 (1986)). Es ist wenig über die genaue Lokalisierung von Epitopen auf gp 120 bekannt, die in HIV-infizierten Patienten entweder immunisierend wirken oder zur Neutralisierung von Antikörpern Anlass geben. Es wurde jedoch gezeigt, dass das rekombinante Protein PB1 (Putney et al., Science, 234: 1392 (1986)), das ungefähr ein Drittel des gesamten gp120-Moleküls verschlüsselt, den Teil des Hüllenproteins einschließt, der die Bildung neutralisierender Antikörper induziert.

Die bis heute gesammelten Daten lassen vermuten, dass weder PB 1 noch unversehrtes gp120 zur Verwendung in einem Impfstoff gegen HIV-Infektionen geeignet ist. Untersuchungen an Ziegen und Schimpansen zeigen, dass kein Molekül die Erzeugung hoher Titer an neutralisierenden Antikörpern induzieren kann. Es wurde darüber hinaus gezeigt, dass sich das unversehrte gp120-Molekül an das T4-Molekül normaler T-Zellen anlagert und die normale Immunfunktion stören kann. Insbesondere stört das ganze gp120-Hüllenmolekül die normale CD4 (T4)-Funktion und unterdrückt die T-Zellenaktivierung in vitro (Mann et al., J. Immunol. 138: 2640 (1987)). Folglich kann die Verabreichung von Impfstoffen, die große Teile des externen Hüllenglycoproteins umfassen, in der Tat für das normale Immunsystem schädlich sein.

Es ist offenkundig geworden, dass die Verschiedenheit der HIV-Sequenz in der neutralisierenden Hauptdomäne von gp120 (der V3 gp120 umhüllende Windungsbereich) und die hohe Mutationsgeschwindigkeit der V3 Windungssequenz ein Haupthindernis ist, das bei der Impfstoffentwicklung zu überwinden ist (Myers et al., Human Retroviruses and Aids, 1991; LaRosa et al., Science, 249: 932-935 (1990); und Holley et al., PNAS (USA), 88: 6800-6804 (1991). Nichtsdestoweniger laufen Untersuchungen, um die kritische Rolle aufruzeigen, die der gp120 V3-Bereich bei der Erzeugung neutralisierender anti-HIV Antikörper spielt (Jiang et al., J. Exp. Med., 174: 1557-1593 (1990)). Darüber hinaus wurde kürzlich gezeigt, dass ungefähr 50% der gegenwärtigen HIV-Isolate mit V3-Sequenzen übereinstimmen, die dem HIV-Isolat MN ähnlich sind, und dass ungefähr 80% der HIV-Isolate in den USA zu einer der 4 am häufigsten vorkommenden HIV-Sequenzen gehören (Myers et al., Human Retroviruses and Aids (1991); LaRosa et al., Science 249: 932-935 (1990); und Holley et al., PNAS (USA) 88: 6800-6804 (1991)). Weiterhin haben zwei dieser Sequenzen, GPGRAF und IHIGPGRA, stark kreuzreaktive HIV neutralisierende Antikörper in Tieren induziert (Jahaverian et al., Science, 250: 1590-1593 (1990) und Haynes et al., AIDS Res. Humans. Retroviral., 6: 38-39, (1990)).

Demzufolge ist bei der Entwicklung eines Impfstoffs gegen HIV die Erzeugung einer Antikörperwirkung gegen gp 120 problematisch, welche die Wechselwirkung von gp 120 mit dem CD4 (T4)-Molekül stört, aber die normale CD4 (T4)-Wechselwirkung mit gewebeverträglichen Hauptmolekülen der Klasse II nicht stört, eine normale Hauptfunktion des CD4 (T4)-Moleküls, bei der Vermittlung unzähliger Vorgänge bei der normalen Wirkung von T-Zellen. Zusätzlich wird ein wirksamer Impfstoff gegen HIV eine schützende, immunisierende Wirkung in Primaten und im Menschen induzieren, d. h. wird eine anschließende HIV- Infektion nach deren Auftreten verhindern.

Ein Immunisierungsmittel, das für etwa 80% der HIV-Stämme heilsame (schützende) anti-HIV Immunwirkungen induziert, hätte in mindestens dreierlei Hinsicht eine große klinische Verwendung. Erstens würde die erfolgreiche Immunisierung von HIV negativen IV Drogenkonsumenten, Strafgefangenen und homosexuellen Bevölkerungsgruppen, die als ein hohes Risiko bei der Übertragung der HIV-Infektion angesehen werden, die epidemische Ausbreitung der HIV-Infektionen beträchtlich mindern. Wenn zweitens die Immunisierung HIV-infizierter Mütter während der ersten drei Monate der Schwangerschaft eine heilsame anti-HIV-Viruswirkung fördern und die HIV-Übertragung um 80% senken könnte, dann würde bei Kindern von HIV-infizierten Müttern die HIV-Übertragung von der Mutter auf den Fötus von 30% auf 8% sinken. Drittens wäre ein Immunisierungsmittel gegen HIV, das eine heilsame und nicht pathogene anti-HIV-Wirkung induziert, bei der Immunisierung von HIV-infizierten, unsymptomatischen Personen nützlich, um bei HIV-infizierten, unsymptomatischen Personen, die Anti-HIV-Immunisierungswirkung zu fördern und die Aufrechterhaltung des unsymptomatischen HIV-Infektionszustandes zu bewirken.

Parker et al., Proc. Natl. Sci. USA, 85: 11932-11936 (1988) geben ein synthetisches Peptid (SP10IIIB) mit einer Aminosäuresequenz an, die den Aminosäuren 303-321 eines HIV- Hüllenglycoproteins entspricht. Hart et al., The Journal of Immunology. 145: 2677-2685 (1990) geben synthetische Peptide an, die T- und B-Zellenepitope der HIV-Hülle gp 120 enthalten, die in Rhesusaffen proliferative anti-HIV-Wirkungen und hohe Titer an neutralisierenden Antikörpern induzieren. US-A-5,013,548 und US-A-5,019,387 geben immunisierende Peptidpräparationen an, umfassend Aminosäuresequenzen, entsprechend antigenen Determinanten des HIV-Hüllenglycoproteins, die direkt oder über ein Abstandsmolekül an Trägermoleküle gekoppelt sind, welche für die Impfung von Säugern geeignet sind.

Gegenstand der Erfindung

Gegenstand der vorliegenden Erfindung ist die Bereitstellung eines Peptids, das, wenn es kovalent an eine Trägermolekül gebunden und/oder unter Bildung molekularer Aggregate polymerisiert ist, in Säugern die Erzeugung hoher Titer HIV neutralisierender Antikörper zu induzieren vermag, wobei die Peptide die normale Immunfunktion nicht stören.

Ein anderer Gegenstand der Erfindung ist die Bereitstellung eines synthetischen Impfstoffs, umfassend ein Peptid mit einer Aminosäuresequenz, entsprechend einer antigenen Determinante des Hüllenglycoproteins von HIV, das in der Lage ist, in Säugern ein schützende Immunisierung gegen HIV zu induzieren.

Ein weiterer Gegenstand der Erfindung ist die Bereitstellung eines Impfstoffs, der in der Lage ist, eine schützende Immunisierung in Säugern gegen unterschiedliche Formen von HIV zu induzieren.

Zusammenfassung der Erfindung

Die Erfindung stellt ein Peptid der allgemeinen Formel

F-Th-SP10 (X)

Th-SP10 (X)

Th-SP10

oder

F(X)

bereit, worin:

F für eine Aminosäuresequenz steht, ableitbar von der mutmaßlich fusogenen Domäne von HIV env gp41 oder eine funktional dazu äquivalenten Sequenz;

Th für eine Aminosäuresequenz steht, umfassend ein T-Helferepitop;

SP10 für ein hydrophiles Peptid steht, umfassend eine Aminosäuresequenz von bis zu etwa 35 Einheiten Länge und entsprechend mindestens einer antigenen Determinante des Hüllengylcoproteins von HIV, das von B-Lymphozyten erkannt wird, wobei das Peptid in der Lage ist, wenn es kovalent an ein Trägermolekül gebunden ist, in einem Säuger die Erzeugung von hohen Titern von schützenden, typspezifischen Antikörpern gegen HIV zu induzieren; und

(X) für eine Aminosäuresequenz steht, entsprechend einer HIV-Proteinsequenz, die von beschränkt zytotoxischen T-Zellen der MHC Klasse I oder Klasse II erkannt wird. Die Erfindung stellt auch ein Mimetop einer Konformationsdeterminante des nativen HIV gp120 C4-V3-Bereichs zur Verwendung zum Induzieren von Antikörpern in einem Primaten bereit, die den menschlichen Immunschwächevirus (HIV) neutralisieren.

Zusätzlich stellt die Erfindung auch ein Verfahren zum Serientesten der Peptide bezüglich ihre Fähigkeit zur Erzeugung von neutralisierenden Antikörpern gegen mehr als ein HIV-Isolat bereit, umfassend

i) Inkontaktbringen eines der Peptide in vitro mit einem monoklonalen Antikörper, der eine Konforamtionsdeterminante des nativen HIV gp120 C4-V3-Bereichs erkennt, unter solchen Bedingungen, dass eine Bindung auftreten kann, und

ii) Ermitteln, ob das Peptid an einen monoklonalen Antikörper bindet.

Kurze Beschreibung der Zeichnungen

Fig. 1: Rekombinante Proteine im Vergleich zu synthetischen Peptiden.

Fig. 2: Reaktivität von Antikörpern von AIDS-Patienten im Vergleich zu synthetischen Peptiden.

Fig. 3: gp120-Reaktivität von Antikörpern von HIV+-Patienten, die über Affinitätssäulen synthetischer Peptide gereinigt wurden.

Fig. 4: Neutralisation von HTLVIIIB durch Ziegenantiseren anti-SP10.

Fig. 5: Isolat-spezifische Neutralisation von HIV.

Fig. 6: Bindung von Ziegenserum anti-SP10 an HTLVIIIB, aber nicht an HTLV- IIIRF-infizierte H9 T-Zellen.

Fig. 7: Vergleich der Fähigkeit verschiedener T1-SP10-Peptide aus der Hülle von HIVMN zur Induzierung von anti-T1-SP10 MN-Antikörper in Balb/c-Mäusen. Jeder Punkt entspricht dem niedrigsten Niveau Serumantikörper anti-T1-SP10 in 4-5 Mäusen, bestimmt mittels ELISA-Versuch in 96 Tüpfelplatten unter Verwendung das Peptids T1-SP10 MN als Antigen auf der Platte. Die Werte sind in Form des E/C-Verhältnisses zwischen der optischen Dichte (OD) der Immunisierung nach der Blutentnahme (E) und der optischen Dichte (OD) vor der Blutentnahme (Kontrollprobe) OD angegeben. Die Werte zeigen, dass T1-SP10 MN (A)-. F-T1-SP10MN- und F-T1-SP10MN(A)-Peptide nach 2 Immunisierungen höhere Titer an T1-SP10MN-Antikörper induzieren als T 1-SP10MN selbst.

Fig. 8: Vergleich der Fähigkeit verschiedener T1-SP10-Peptide aus der Hülle von HIVMN zur Induzierung von Antikörpern in Balb/c Mäusen, welche HIVMN beim Synzytiuminhibierungsversuch in vitro neutralisieren. Jeder Balken gibt die Ergebnisse von 3 Blutentnahmen bei einer Maus wieder, die mit der angegebenen Form von T1-SP10 immunisiert worden war. Die Balkenhöhe gibt die prozentuale Synzytiumbildung bei der Inhibierung mit einer Verdünnung von 1 : 10 mit Serum an, verglichen mit dem Serum bei gleicher Verdünnung vor der Blutabnahme.

Fig. 9 zeigt die Antikörpertiter beim ELISA-Versuch, aufgetragen gegen immunisierende Peptide über die Zeit in Schimpansen, die mit synthetischen HIV env Peptiden immunisiert worden waren.

Fig. 10 zeigt die Auswirkung von T1-SP10IIIB(A)-Peptide auf die Wucherung einkerniger peripherer Blutzellen bei Inkorporationsversuchen mit Tritium-markiertem Thymidin während 7 Tagen.

Fig. 11 zeigt die Auswirkung von PBMC Wucherungen bei mit T1-SP10-Peptiden und F-T1-SP10-Peptiden immunisierten Schimpansen gegenüber PHA.

Fig. 12 zeigt Ziegen, die mit der gleichen Charge immunisiert wurden, mit der die Schimpansen 884, 1028, 1045 und 1070 immunisiert wurden.

Fig. 13 zeigt neutralisierende anti-HIVMN-Antikörper in Rhesusaffen, die mit T1- SP10MN-Peptiden immunisiert wurden. Die Werte repräsentieren Titer, die einer 90% Neutralisation beim Synzytiuminhibierungsversuch entsprechen.

Fig. 14 zeigt Antikörper zur Immunisierung von Peptiden in Rhesusaffen, die mit T1- SP10MN(A)-Peptid immunisiert wurden.

Fig. 15 zeigt Spiegel neutralisierender Antikörper beim Synzytiuminhibierungstest mit dem Serum von Rhesusaffen, die mit F-T1-SP10MN(A)-Peptid immunisiert wurden.

Fig. 16 zeigt Titer von Serum-Antikörpern im Vergleich zu immunisierenden Peptiden in Rhesusaffen, die mit F-T1-SP10MN(A)-Peptid immunisiert wurden.

Fig. 17 zeigt die Absorption gegenreaktiver, neutralisierender Antikörper, die durch das T1-SP10MN(A)-Peptid im Rhesusaffen 18987 induziert wurden, welche die Sequenz GPGRAF enthalten. Wie dargestellt, filterte weder ein T1 enthaltendes Peptid noch ein Peptid mit der Sequenz T1-SP10MN(A) neutralisierende Antikörper heraus. Nur Peptide mit GPGRAF filterten die neutralisierende Wirkung heraus und zeigten damit, dass dieses Tier den GFGRAF-Bereich der V3 HIV gp120-Windung selektiv als immunisierend erkannte und für diesen Bereich gegenreaktive Antikörper produzierte.

Fig. 18: Titer neutralisierender Antikörper als Funktion von HIV III/B/LAT (durchgezogene Linien) und HIVMN (gestrichelte Linien) im Serum der vier Schimpansen, die mit T1-SP10IIIB- oder F-T1-SP10IIIB(A). Peptiden immunisiert und anschließend mit T1-SP10 MN(A)-Peptid immunisiert wurden. Die Titer neutralisierender Antikörpern wurden im Synzytiuminhibierungsversuch bestimmt.

Fig. 19: Details siehe Legende zu Fig. 9. Durchgezogene Linien zeigen Antikörpertiter als Funktion das T1-SP10IIIB-Peptids; gestrichelte Linien geben Antikörperwirkung als Funktion des T1-SP10MN(A)-Peptids wieder.

Fig. 20: Absorption der neutralisierenden Antikörper im Serum des Schimpansen 1070 als Funktion des HIVMN-Isolats durch SP10MN(A)-Peptide und Teilabsorption durch das DP2-Peptid.

Fig. 21: Induzierung hoher neutralisierenden Antikörperspiegel als Funktion von HIVMN mit T1-SP10MN(A)-Peptid in Rhesusaffen.

Fig. 22: Induzierung von anti-T1-SP10MN(A)-Peptidantikörper mit T1-SP10MN(A)- Peptid in Rhesusaffen.

Fig. 23: Induzierung hoher Spiegel neutralisierender anti-HIV MN Antikörper mit T1-SP10MN(A)-Peptid.

Fig. 24: Induzierung von Antikörpern gegen das F-T1-SP10MN(A)-Peptid mit F-T1- SP14MN(A)-Peptid als Immunisierungsmittel in Rhesusaffen. Bei dem in den Fig. 22, 24 verwendeten Versuchen war das Verhältnis ELISA-Endpunkt/immunisierendes Peptid (E/C) größer als 2,9.

Fig. 25: Absorption der neutralisierenden Antikörper im Serum als Funktion des HIV IIIB-Isolats bei SP10MN(A)- und DP2-Peptiden.

Fig. 26: Bauplan A ist ein allgemeiner Entwurf eines Prototyps des als T1-SP10(A) bezeichneten C4-V3-Peptids aus dem HIV-Isolat MN mit 2 T-Helferdeterminanten im hybriden Peptid, wovon ein CTL-Epitop der MHC Klasse I durch B7 beschränkt und ein zweites CTL-Epitop durch HLA-A2 beschränkt ist. Bauplan B zeigt das Th-CTL-Peptid, entworfen nach der Hülle des Affenimmunschwächevirus und dem gag-Protein des Affenimunschwächevirus. Dieses Peptid wurde verwendet, um die Fähigkeit des Peptids zu demonstrieren in Primaten beschränkte anti-SIV CTL der Klasse I zu erzeugen, wie von Yasutomi et al. (J. Immunol. 1541: 5096 (1993) beschrieben.

Fig. 27: Sequenz der T1-SP10(A) Th-B-Tc-Peptide ihr die Immunisierung beim Menschen.

Fig. 28: Mab 48d bindet sich an das C4-V3-Peptid T1-SP10CANO(A), wohingegen der monoklonale Antikörper 17b dies nicht tut. Steigende Mengen an monoklonalem Antikörper wurden auf ELISA-Platten aufgegeben, die mit dem T1-SP10CANO (A) C4-V3-Peptid beschichtet waren (2 ug/Kalotte), wie im einzelnen in Haynes et al. (J. Immunol., 151: 1646 (1993) J. Exp. Med. 177: 717, 1993) beschrieben. Fig. 28 zeigt, dass sich mab 48d an das T1-SP10CANO (A)-Peptid gebunden hatte, der Antikörper 17b dies aber nicht tat. Diese Platte wurde mit 8 molarem Harnstoff abgewaschen (eine Behandlung, von der kürzlich gezeigt worden war, dass sie die Bindung von Antikörpern an lineare Determinanten von Peptiden auf der Platte nicht stört) und gezeigt, dass die Behandlung des Peptids mit 8 molarem Harnstoff das Peptid denaturiert und der anschließenden Bindung von 48d an das Peptid vorbeugt. Diese Werte lassen stark vermuten, dass der Antikörper 48d an die Konformationsdeterminante auf dem C4-V3-Peptid T1-SP10CANO(A) gebunden vorliegt.

Fig. 29: Zur maximalen Peptidbindung an mab 48d wird das gesamte T1-SP10CANO (A)-Peptid benötigt. Sowohl das T1-Peptid (C4-Bereich allein), das V3-Peptid [SP10CANO (A)], das C4-V3-Peptid [T1-SP10CANO(A)] als auch ein Gemisch gleicher Mengen von C4 (T1) + V3 [SP10CANO(A)] wurden auf einer ELISA-Platte mit einer Gesamtkonzentration von 2 ug/Kalotte inkubiert. Aus Fig. 29 ist ersichtlich, dass sich der als Kontrollprobe verwendete Antikörper DU.HP20 an keines dieser Peptide band, wohingegen sich 48d mab an das SP10CANO(A)-Peptid band, und deutlich besser, an die C4-V3-Version des T1-SP10CANO (A)-Peptids. Das Mischen von T1 mit dem SP10CANO(A)-Peptid erhöhte die Anbindung von 48d nicht.

Fig. 30: allgemeines Schema für einen HLA basierenden Impfstoff für AIDS.

Detaillierte Beschreibung der Erfindung

Die vorliegende Erfindung betrifft Peptide, welche immunisierenden Epitopen von HIV entsprechen und daraus hergestellte synthetische Impfstoffe. Diese neuen immunisierenden Mittel werden durch chemische Synthese erzeugt, die antigene Determinanten mit dem Hüllenprotein von HIV gemeinsam haben. Die Peptide sind an Trägermoleküle gebunden (und/oder sind polymerisiert), welche sie als Impfstoffe geeignet machen. Diese Impfstoffe sind bei der Verabreichung an Säuger, zum Beispiel auf parenteralem Wege, zur Immunisierung gegen AIDS nützlich.

Man ist übereingekommen, dass Peptide, die auf ihre immunisierenden Fähigkeit hin untersucht werden sollten, jene einschließen sollten, die hydrophilen, geladenen Bereichen des Hüllenglycoproteins von HIV entsprechen. Man ist ferner übereingekommen, dass von solchen Peptiden jene mit mutmaßlichen β-Windungen wahrscheinlich besonders wichtig sein würden. Es wurde davon ausgegangen, dass die Bildung intrapeptidaler Disulfidbrücken für die Entstehung nativer Konformationsdeterminanten nützlich sein würden. Es wurde auch davon ausgegangen, dass die Bildung von Disulfidbrücken zwischen den Ketten für die Polymerisation von Peptidmolekülen zu größeren, stärkeren, immunisierenden Peptidaggregaten nützlich sein würde.

Die Computeranalyse der angenommenen Aminosäuresequenz des Hüllenproteins von HTLVIIIB und von ARV-2-Isolaten von HIV bestätigte die Sekundärstruktur und die Lage hydrophiler Bereiche. Die Sekundärstruktur wurde mittels einer Computeranalyse unter Verwendung des Verfahrens von Chou und Fasman (Biochemistry, 13: 211 und 13: 222 (1974); Advances in Enzymology, 47: 45(1978)) bestimmt. Die möglichen Bereiche von β-Windungen wurden unter Verwendung des Verfahrens von Rose (Nature 272: 586, 1978) lokalisert. Die hydrophilen Bereiche auf dem Hüllenprotein wurden nach der Methode von Rose und Roy (Proc. Natl. Acad. Sci. (USA), 77: 4643 (1980)) identifiziert.

Die SP10-Peptide der vorliegenden Erfindung entsprechen B-Zellepitopen oder sind mit diesen homolog, die im Zentralbereich des Hüllenproteins HTLVIIIB des HIV-Isolats oder in Hüllenproteinen verwandter HIV-Isolate, vorliegen. Die erfindungsgemäßen SP10- Peptide weisen der Länge nach etwa 35 Aminosäuren (Einheiten) oder weniger auf, sind hydrophil, und bewirken an geeignete Trägermoleküle gebunden, die Erzeugung von hohen Titern typspezifischer HIV-immunisierender Antikörper (oder Isolate) in Säugern. (d. h. vorteilhafterweise eine Herabsetzung des Infektionsgrades von 100 Infektionseinheiten auf ungefähr 80% in vitro bei einer Serumverdünnung von 1 : 600). Im Gegensatz zu intakten gp120- Molekülen sind die SP10-Peptide selbst nicht in der Lage die Wechselwirkung zwischen dem CD4 (T4)-Molekül auf der Oberfläche von T-Lymphozyten und Phagozyten von HLA-Molekülen der Klasse II zu inhibieren, und stören demzufolge die normale Immunisierungswirkung nicht. Das heißt, die erfindungsgemäßen SP10-Peptide, welche neutralisierende anti-HIV- Antikörper induzieren können, inhibieren in vitro antikörperspezifische normale T-Zellwucherungen nicht.

Die SP10-Peptide der vorliegenden Erfindung können zum Beispiel die Sequenz CTRPNNNTRKSIRIQRGPG (Bezeichnung SP10) aufweisen, entsprechend den Aminosäuren 303-321 des HTLVIIIB-Hüllenglycoproteins gp120 (Ratner et al., Nature, 313: 277, (1985)) oder einem Teil dieser Sequenz. Die erfindungsgemäßen SP10-Peptide können auch Sequenzen umfassen, die den analogen SP10-Bereichen anderer HIV-Isolate als HTLVIIIB entsprechen oder Teilen davon, wobei diese Sequenzen als "SP10-ähnlich" (vergl. zum Beispiel die Sequenzen in Tabelle I) bezeichnet werden.

Tabelle 1 SP10-IIIB und SP10-ähnliche Sequenzen

Der Ausdruck "SP10-ähnlich" schließt in seiner Bedeutung die SP10IIIB-Sequenz selbst ein.

Trägermoleküle, an welche die erfindungsgemäßen SP10-Peptide kovalent gebunden (konjugiert) sind, sind vorteilhafterweise ungiftig, pharmazeutisch verträglich und groß genug, um eine Immunisierungswirkung in Säugern zu erzeugen. Beispiele geeigneter Trägermoleküle beinhalten Tetanus-Toxoid, Keyhole Limpet Hämocyanin (KHL)) und Peptide, entsprechend T-Zellepitopen (d. h. T1 und T2) des gp120-Hüllenglycoproteins, das nicht von AIDS-Viren abgeleitete Trägermoleküle ersetzen kann (Cease, Proc. Natl. Acad. Sci. (USA), 84: 4249 (1987); Kennedy et al., J. Biol. Chem., 262: 5769 (1987)). Peptide können auch mit pharmazeutisch verträglichen Hilfsstoffen, wie zum Beispiel Alaun, verabreicht oder an stärker immunisierende Trägermoleküle als Tetanus-Toxoid konjugiert werden.

Die Konjugation eines Trägermoleküls an ein erfindungsgemäßes Peptid kann direkt oder über ein Distanzmolekül erfolgen. Distanzmoleküle sind vorteilhafterweise ungiftig und reaktionsfähig. Zwei an eine endständige Aminogruppe des Peptids angehängte Glycinreste können ein geeignetes Distanzmolekül für die Anbindung SP10-ähnlicher Sequenzen oder von Teilen davon, an ein Trägermolekül liefern; Alternativ können SP10-ähnliche Sequenzen oder Teile davon direkt benachbart, zum Beispiel zu einer anderen immunisierenden Hüllensequenz von HIV, zum Beispiel T1 oder T2, synthetisiert werden. Cystein kann entweder mit dem N- oder C-Terminus eines SP10-ähnlichen Peptids für die Konjugation an das Trägermolekül verknüpft werden oder mit beiden Ende, um die Polymerisation zwischen den Ketten durch die Bildung von Disulfidbrücken unter Bildung großer Molekülaggregate zu erleichtern.

Die Konjugation des Trägermoleküls an das Peptid erfolgt unter Verwendung eines Kopplungsmittels. Vorteilhafterweise wird als heterofunktionelles Kopplungsmittel m-Maleimidobenzoyl-N-Hydroxysuccinimidester (MES) oder die wasserlösliche Verbindung m-Maleimidobenzoylsulfosuccinimidester (sulfo-MES) verwendet, wie von Green et al. (Cell28: 477 (1982)) und von Palker et al. (Proc. Natl. Acad. Sci. (USA) 84; 2479 (1987)) beschrieben.

Erfindungsgemäße Impfstoffe umfassen ein oder mehrere SP10-ähnliche Peptide oder Teile davon, wobei jedes SP10-ähnliche Peptid von einem anderen HIV-Stamm abgeleitet ist, und die Peptide an Trägermoleküle konjugiert sind. Ein polyvalenter Impfstoff, umfassend ein Gemisch synthetischer Peptide, vorteilhafterweise etwa 2 bis 10, dessen Sequenzen zum Beispiel den in Tabelle I aufgeführten Isolaten entsprechen, kann dazu verwendet werden, beim Menschen eine Immunisierung gegen verschiedene Formen von HIV zu erzeugen.

Vorteilhafterweise wird die SP10-Sequenz von HTLVIIIB (vergl. Tabelle I) entweder mit dem HTLVIIIB gp120-Epitop der T-Zellenhülle (Aminosäuren 428-443 von gp120), KQIINMWQEVGKAMYA, oder dem T2-Epitop (Aminosäuren 112-124 von HTLVIIIB gp120), HEDIISLWNQSLK (Cease et al., Proc. Natl Acad. Sci. (USA), 84: 4249 (1987)) synthetisiert, um ein einziges Polypeptid (im Fall von T1-SP10 aus dem HTLVIIIB-Isolat von HIV, KQIINMWQEVGKAMYACTRPNNNTRKSIRIQRGPG). Auf ähnliche Weise können T1- oder T2-Sequenzen aus anderen HIV-Isolaten mit synthetischen Peptiden verknüpft werden, die sich vom SP10-Bereich der entsprechenden Isolate (vergl. Tabelle I) ableiten, vorteilhafierweise mit dem N-Terminus des SP10-ähnlichen Peptids, um ein T1- (oder T2)-SP-ähnliches Peptid zu bilden, das neutralisierende Titer von Antikörpern gegen spezifische Stämme von HIV induzieren kann. Eine Verknüpfung mit dem C-Terminus des SP10-ähnlichen Peptids ist gleichfalls möglich.

Kleinere Anteile SP10-ähnllicher Peptide, zum Beispiel SP14RF(A) und SPlOC (Tabelle II), einschließlich gp120-T-Zellenepitope, können ebenfalls an das Trägermolekül kovalent gebunden und in einem Impfstoff verwendet werden.

Die vorliegende Erfindung betrifft auch einen wirksamen, schützenden Impfstoff gegen Stämme von HIV, umfassend zusätzlich zu den SP10-ähnlichen Sequenzen und geeigneten Trägermolekül(en), Sequenzen aus dem gp120 Hüllenmolekül. Da es einen großen hypervariablen Bereich gibt, der gegenüber den in Tabelle I als SP10-ähnlich bezeichneten Peptiden (Hüllenlaminosäuren 322-333, Ratner et al., Nature 313: 277 (1985)) Carboxyl-terminiert ist, und weil der hypervariable Bereich eine Rolle bei der Verstärkung der Fähigkeit von SP10- ähnlichen Peptiden zur Erhöhung typspezifischer Antikörper spielen kann, können Aminosäuresequenzen, die einem hypervariablen Bereich (ungefähr Aminosäuren 322-333) von HIV-Isolaten entsprechen, teilweise oder als Ganzes als Impfstoffbestandteil eingeschlossen sein, wie für andere SP10-ähnliche Peptide (vergl. zum Beispiel die Sequenzen in Tabelle II) beschrieben. Hypervariable Sequenzen werden vorteilhafterweise C-terminal an das SP10- ähnliche Peptid gebunden. Eine N-terminale Verknüpfung mit dem SP10-ähnlichen Peptid ist gleichfalls möglich.

Die vorliegende Erfindung betrifft auch einen wirksamen, schützenden Impfstoff gegen HIV-Stämme, der zusätzlich zu einer SP10-ähnlichen Sequenz und einem Trägermolekül ein Peptid umfasst, entsprechend dem HIV gp41 Transmembranbereich, der an der virusinduzierten Zellfusion beteiligt ist, FLGFLG (Gallagher, Cell, 50: 327 (1987)). Die FLGFLG-Sequenz wird vorteilhaft an den C- Terminus des SP10-ähnlichen Peptids gebunden. Die Addition an den N-Terminus des SP10-ähnlichen Peptids ist ebenfalls möglich.

Tabelle II SP10 und SP10-ähnliche Sequenzen, die zusätzlich einen carboxylterminalen, hypervariablen Bereich und verkürzte SP10-ähnliche Sequenzen enthalten.

Die vorliegende Erfindung betrifft auch einen wirksamen, schützenden Impfstoff gegen HIV, der von Cystein-T1- (oder T2-)SP10-ähnlichen, vom Cystein-T1- (oder T2-)SP10-ähnlichen hypervariablen Bereich, oder Cystein-T1- (oder T2-)Sp10-ähnlichen-FLGFLG-Polypeptiden; und/oder SP10-ähnlichen Cystein oder Cysteinpolypeptiden mit hypervariablem Bereich SP10-ähnlichen gebildet wird. Die Polypeptide können mit Oxidationsmitteln behandelt werden, um zwischen den Cysteinen in der Polypeptidkette Disulfidbrücken einzuführen, um dadurch polymerisierte und damit hoch immunisierende Antigene zu erzeugen. Die auf diese Weise gebildeten Molekülaggregate umfassen vorteilhafterweise SP10-Peptide, die von mindestens 2 HIV-Isolaten abgeleitet wurden.

Ein erfindungsgemäßer polyvalenter HIV-Impfstoffumfasst vorteilhafterweise zwei oder mehr Konjugate, umfassend eine SP10-ähnliche Sequenz oder einen Teil davon (vergl. zum Beispiel die Sequenzen in Tabelle I), welche von zwei oder mehr HIV-Isolaten abgeleitet sind, und ein Trägermolekül, wie Tetanus-Toxoid; oder zwei oder mehr T1- oder T2-SP10- ähnliche Peptidkonjugate, worin sowohl die T1- (oder T2-) als auch die SP10-ähnlichen Sequenzen, Sequenzen entsprechen, die in einem spezifischen HIV-Isolat vorliegen.

Der Vorteil bei der Verwendung eines synthetischen Peptids als Trägermolekül, das einen Teil des gp120-Moleküls wiederspiegelt, der von T-Helferzellen erkannt wird, besteht darin, dass kein anderes Trägermolekül, wie Tetanus-Toxoid, erforderlich wäre, und die Wirkung von B- und T-Zellen auf HIV spezifisch wäre. Werden in einem polyvalenten Impfstoff verschiedene Peptide kombiniert, welche Sequenzen aus dem SP10-Bereich unterschiedlicher Isolate und möglicherweise den Z-Zellerkennungsbereich der gp120-Hülle wiederspiegeln, wird das Problem der Isolat-spezifischen Neutralisation überwunden.

Die vorliegende Erfindung betrifft auch polyvalente Impfstoffe, die SP10-ähnliche Peptide umfassen, die mit den vorstehend beschriebenen, hypervariablen Sequenzen (vergl. zum Beispiel Tabelle II) verknüpft sind. Ein Gemisch solcher Polypeptide, die an geeignete Trägermoleküle gekoppelt und/oder unter Bildung von Disulfldbindungen polymerisiert worden sind (Harington, C. R. et al., Biochem., J. 30: 1598 (1930); Harington, C. R. et al., Biochem. J., 38: 417 (1944); Weygand et al., Z. Naturforsch., 176: 807 (1962)) können als Impfstoff verwendet werden, um gegenüber einer Vielzahl von HIV-Isolaten eine schützende Antikörperwirkung zu induzieren.

SP10-ähnliche Peptide können bei einem Radioimmunnotest in fester Phase (Palker et al., J. Immunol., 136: 2393 (1986); ibid. Proc, Natl. Acad. Sci. (USA), 84: 2479 (1987)) verwendet werden, um (i) das Vorliegen eines Titers HIV neutralisierender Antikörper festzustellen, und (ii) zu bestimmen, mit welchem HIV-Stamm der Patient infiziert ist. Auf diese Weise können SP10-ähnliche Peptide zusätzlich zu ihrer Verwendung als Impfstoff oder als Bestandteil eines Impfstoffs, wie vorstehend beschrieben, für diagnostische Zwecke verwendet werden. Peptide der vorliegenden Erfindung können auch bei an Standardenzyme gebundenen Immunosorptionsversuchen verwendet werden, um die Anwesenheit von HIV-Antikörpern festzustellen.

Fasst man die spezifischen Gesichtspunkte der vorstehenden Ausführungen zusammen und ergänzt sie, betrifft die vorliegende Erfindung, zumindest in Teilen, ein synthetisches Peptid, das mindestens zwei Bereiche des HIV-Proteins umfasst, den T1 gp120 env-Bereich, der Berichten zufolge sowohl von B-Zellen (Palker et al., J. Immunol., 1242: 3612 (1989)) als auch von T-Helferzellen (Caasa et al., Proc. Natl. Acad. Sci. (USA), 84: 4249 (1987)) erkannt wird, und auch den SP10-ähnlichen gp 120 env-Bereich, einen Bereich, der gleichfalls sowohl von T-Helferzellen als auch von B-Zellen erkannt wird, und das Antikörper induziert, die den menschlichen Immunschwächevirus (HIV) neutralisieren können (vergl. die unmittelbar vorstehend zitierten Literatustellen von Palker et al.; Palker et al., Proc. Natl. Acad. Sci. (USA), 85: 1932 (1988); und auch Rusche et al., Proc. Natl. Acad. Sci. (USA,) 85: 3198-3202 (1988) und Goudsmit et al., Proc. Natl. Acad. Sci. (USA), 85: 4478 (1988)) (vergl. Tabellen III und IV).

Tabelle III Varianten des von den HIVMN-Hüllensequenzen abgeleiteten T1-SP10-Peptids

Sequenzen aus Meyers et al. Human Retroviruses and AIDS, 1988, Los Alamos National Laboratory, Los Alamos, New Mexico, S. 11 68-92.

Tabelle IV Varianten des von den HIVIIIB-Hüllensequenzen abgeleiteten T1-SP10-Peptids

Sequenzen aus Ratner et al., Nature, 313: 277 (1985).

Neutralisierende Antikörper, die von T1-SP10-ähnlichen Peptiden erzeugt werden, sind insofern spezifisch, als die Antikörper als Gegenmittel gegen das HIV HTLVIHB (IIIB)-Isolat gezüchtet werden, die HIV-Isolate HTLVI HMN (MN) oder HTLVIIIRF (RF) nicht neutralisieren (Palker et al., J. Immunol., 142: 3612 (1989)). Auf ähnliche Weise neutralisieren Antikörper als Gegenmittel gegen das T1-SP10-ähnliche Peptid, die Sequenzen der HIV-Isolate MN oder RF die homogenen Isolate, neutralisieren aber keines der beiden anderen HIV-Isolate. Als jedoch T1-SP10-ähnliche Antiseren von Ziegen in Nordkarolina gegen 9 HIV-Feldisolate getestet wurden, wurde festgestellt, dass das anti-T1-SP10IIIB-Serum 1 von 9 HIV-Isolaten neutralisiert, anti-T1-SP10RF 3 von 9 HIV-Isolaten neutralisiert und anti-T1-SP10MN 6 von 9 HIV-Isolaten neutralisiert (Haynes et al., AIDS Res. Retrol., 6: 38 (1990) (vergl. Tabelle V).

Tabelle V Fähigkeit von anti-T1-SP10-Serum zur Neutralisation von Nordkarolina HIV-Feldisolaten

LaRosa et al. (Science 249: 932 (1990)) haben gezeigt, dass das von Haynes et al. in AIDS Res. Retrol. (vorstehend) beschriebene HIVMN-Motiv eines der vorherrschenden Motive von HIV-Isolaten ist, die von AIDS-Patienten von überall in den Vereinigten Staaten gezüchtet wurden.

Palker et al. (J. Immunol., 142: 3612 (1989) haben als Erste berichtet, dass die Strategie des Mischens von Peptiden aus verschiedenen Isolaten eine erfolgreiche Lösung für das Problem der Züchtung von Antikörpern gegen zahlreiche Stämme von HIV mit unterschiedlichen Aminosäuresequenzen im Bereich von 303-337 der HIV-Hülle sein könnte. Darüber hinaus berichteten Palker et al., dass das T1-SP10-ähnliche Peptid gegenüber synthetischen Peptiden die an Trägermoleküle, wie KLH oder Tetanus-Toxoid gekoppelt sind, Vorteile aufwies. Wohingegen an Träger gekoppelte Peptide nur große Mengen von Antikörpern gegen den Träger in polyvalenten Peptidgemischen induzieren, induzierte, wenn die T1-Sequenz von HIVIIIB env (Aminosäuren 429-443) N-terminal an die SP10-Sequenz (Aminosäuren 303- 321) kovalent gebunden war, dieses trägerfreie Immunisierungsmittel hohe Titer an neutralisierenden Antikörpern gegen alle drei HIV-Isolate, deren Sequenzen in den T1-SP10-Peptiden vorlagen. Darüber hinaus haben Hart et al. (J. Immunol., 1990) kürzlich gezeigt, dass das T1- SP10-Peptid gegenüber Immunzellen in Rhesusaffen ungiftig ist und in diesen Primaten in vivo hohe Titer an neutralisierenden Antikörpern und T-Helferzellen induziert. Demzufolge ist die Konstruktion des T1-SP10-ähnlichen synthetischen Peptids ein einfaches und hochwirksames Molekül zur Induzierung neutralisierender anti-HIV Antikörperwirkungen und T-Helferzellenwirkungen bei Ziegen und Primaten.

Eines der Hauptprobleme bei der Entwicklung eines Impfstoffs für AIDS war die Frage, ob Antikörperwirkungen allein eine Person sowohl gegen zellfreie HIV als auch gegen HIV- infizierte Zellen schützen kann, oder ob außerdem durch Zellen vermittelte Immunisierungswirkungen (antigenspezifische zytotoxische T-Zellen) benötigt werden. Es ist sicher, dass viele andere Virusinfektionen beides, Antikörper und zelluläre anti-Virus-Immunisierungswirkungen zur Erzeugung einer schützenden Immunität benötigen (Long et al.., Immunol. Today, 10: 45 (1989)). Zusätzlich kann eine lokale Immunität an Schleimhautoberflächen, bestehend aus IgG- und IgA-Antikörperwirkungen und die Aktivität mit der Schleimhautoberfläche assoziierter zytotoxischer T-Zellen erforderlich sein, um gegen die Übertagung von HIV beim Sexualkontakt und dem Inkontaktbringen von Schleimhautoberflächen mit infiziertem Blut zu schützen. Folglich wäre ein Immunisierungsmittel auf der Basis eines synthetischen Peptids erwünscht, das zusätzlich zur Induzierung neutralisierender Antikörper- und T-Helferzellenwirkungen zytotoxische T-Zell(CTL)-Wirkungen induziert. Zusätzlich zu den offen gelegten und vorstehend zusammengefassten Ausführungsformen, betrifft die vorliegende Erfindung ein solches Immunisierungsmittel.

Der F-Bereich (zum Beispiel die Aminosäuren 519-530 des HIV-Isolats BH10/IIIB und homologe Bereiche anderer Isolate von HIV-1, HIV-2 und des Menschenaffenimmunschwächevirus (51 V)) weisen eine Sequenzhomologie mit F1 (Fusions)-Peptiden von Paramyxoviren auf (Gallagher, Cell, 50: 327 (1987)). Es wurde als gegeben vorausgesetzt, dass der F-Bereich eine hydrophobe Helixstruktur bildet, die sich zwischen die Lipiddoppelschichten der Zellmembranen schieben und eine Zellverschmelzung auslösen kann. Bosch et al. (Science, 244: 694 (1989)) haben gezeigt, dass der F-Bereich im SIV (das ist der zu 519-530 env gp41 homologe Bereich des HIV-Isolats BH10/IIIB) tatsächlich die Zellfusion SIV-infizierter Zellen vermittelt.

Es wurde gefunden, dass F-derivatisierte Peptide in einer solchen Weise in Immunzellen eingeführt werden, wie bei der Induzierung der gleichen Art zytotoxischer T-Zellwirkungen, die nötig ist, um viele Virusinfektionen zu kontrollieren, nämlich die Erzeugung von HLA beschränkt zytotoxischen T-Zellen DV8+.F-derivatiserte Peptide treten bei der Injektion in einen Säuger in einer solchen Weise in Wechselwirkung, dass sie die Aktivität der anti-HIV-Memory T-Helferzellen, anti-HIV neutralisiernde Antikörper und Memory anti- HIV CD8+, HLA Klasse I beschränkt zytotoxische T-Zellwirkungen induzieren.

Die F-Sequenzen stammen von der mutmaßlich fusogenen Domäne von HIV env gp41 (zum Beispiel Aminosäuren 519-530 im HIV-Isolat BH10/IIIB oder homologen Bereichen anderer HIV-1-, HIV-2- oder SIV-Isolate, oder damit funktional gleichwertiger Sequenzen). Die Sequenzen sind entweder die T1- oder T2-Helferepitope oder alternativ irgendwelche der in Tabelle X (nachstehend) aufgeführten T-Helferzellenepitope oder Aminosäuresequenzen aus anderen Bereichen nicht aufgeführter HIV-Proteine, die jedoch als T-Helferepitope fungieren.

SP10-ähnliche Sequenzen stammen von Tabelle I oder II (vergl. auch Tabelle VIII nachstehend) oder von beliebigen SP10-ähnlichen Sequenzen von HIV-Feldisolaten (vergl. zum Beispiel LaRosa et al., Science, 249: 932 (1990)); und

(X)-Sequenzen sind HIV-Proteinsequenzen, die von der MHC Klasse I oder Klasse II beschränkt zytotoxischer T-Zellen erkannt werden. Beispiele von (X)-Bereichssequenzen sind in den nachstehenden Tabellen VIII und IX aufgeführt.

Alternativ können F-Sequenzen zum Beispiel gegenüber Th-SP10(X)-Sequenzen C-terminal vorliegen. Darüber hinaus können Th-SP10- und (X)-Sequenzen in beliebiger Reihenfolge in der Peptidstruktur angeordnet werden.

Das immunisierende synthetische Peptid dieser erfindungsgemäßen Ausführungsform ist in der Lage neutralisierende anti-HIV-Antikörper und anti-HIV zytotoxische ("Killer")-T- Zellen zu induzieren. Der Fachmann wird erkennen, dass dieses Immunisierungsmittel (das ein Fusionsprotein ist) entweder chemisch oder nach rekombinanten Verfahren nach dem Stand der Technik synthetisiert werden kann.

Das Immunisierungsmittel kann zum Beispiel die Struktur F-T1-SP10-(A) besitzen.

Wenn auch Beispiele solcher Immunisierungsmittel in den Tabellen III und IV aufgeführt sind, wird es der Fachmann zu schätzen wissen, dass beliebige SP10-ähnliche Sequenzen von HIV-Isolaten aus dem Feld und Labor (zum Beispiel LaRosa et al., Science, 249: 932 (1990)) die in den Tabellen III und IV angegebenen Sequenzen ersetzen können (vergl. auch Tabelle I und II).

Die T1-ähnlichen Sequenzen können aus T1-homologen Sequenzen von beliebigen sequenzierten HIV-Isolaten ausgewählt werden, einschließlich aus den in Tabelle VI aufgeführten.

Tabelle VI T1-Sequenzen der HIV-Hülle gp120 manigfaltiger HIV-Isolate

Die Sequenzen für BH10 sind die Aminosäuren 428-443 aus Ratner, L. et al., Nature, 313: 277-284, 1985. Die Sequenzen für die restlichen HIV-1- und HIV-2-Isolate stammen von Meyers et al., Human Retroviruses and AIDS, 1988, Los Alamos National Laboratory, Los Alamos, New Mexico, S. II-89

: = keine Aminosäure

Die F-ähnlichen Sequenzen können aus F-homologen Sequenzen von beliebigen sequenzierten HIV-Isolaten ausgewählt sein, einschließlich den in Tabelle VII aufgeführten.

Tabelle VII Fusionsproteinsequenzen (F) der HIV-Hülle gp41 manigfaltiger HIV-Isolate

Die Sequenzen für BH10 sind die Aminosäuren 519-530 aus Ratner, L. et al., Nature, 313: 277-284, 1985. Die Sequenzen für die restlichen HIV-1- und HIV-2-Isolate stammen von Myers et al., Human Retroviruses and AIDS, 1988, Los Alamos National Laboratory, Los Alamos, New Mexico, S. II-90. Die WMJ1-Sequenz stammt von Brasseur et al., AIDS Res. Hum. Retrovirol. 4; 83-909, 1988.

: = keine Aminosäure

Die (A)-Bereichs-ähnlichen Sequenzen können aus (A)-homologen Sequenzen beliebiger HIV-Isolate ausgewählt sein, einschließlich den in Tabelle II und VIII aufgeführten.

Die Erfindung betrifft weiterhin ein Peptid, welches die F-Bereichssequenz (d. h. zum Beispiel die Aminosäuren 519-530 des BH10/IIIB-Isolats oder andere homologe Bereiche anderer HIV-1-, HIV-2- oder SIV-Isolate) von HIV gp41 umfasst, die N-terminal zu SP10 oder SP10-ähnlichen Bereichen einer beliebigen HIV-Sequenz (vergl. zum Beispiel Tabelle II) von Feldisolaten so angeordnet (kovalent verknüpft) ist, dass das resultierende Strukturelement neutralisierende Antikörper und zytotoxische Z-Zellen gegen HIV induzieren kann.

Tabelle VII SP10- und SP10-ähnliche- und (A)-Bereichs gp120-Sequenzen manigfaltiger HIV-Isolate

Die Sequenzen für BH10 stammen von Ratner et al. Nature, 313: 270-284 (1985).

Der Fachmann wird beim Studium der vorliegenden Offenbarung erkennen, dass auf die MHC Klasse 1 beschränkte zytotoxische T-Zellen bei der Verabreichung in vivo induziert werden können, beispielsweise des Aminosäurebereichs 519-530 von HIVgp41, der aus 12 Aminosäuren besteht: AVGIGALFLGFL (F), oder aus F-Bereichssequenzen anderer HIV-1-, HIV-2- oder SIV-Isolate (vergl. zum Beispiel Tabelle VII), welche mit der Aminosäuresequenz 519-530 des Isolats BHIO/IIIB (Tabelle VII) homolog sind, wobei sie kovalent an irgendein anderes Peptid mit einer Länge von beispielsweise 3 bis 50 Aminosäuren so gebunden sind, dass das F-verknüpfte Peptid mit Antigen-liefernden Zellen in einer solchen Weise verbunden ist, dass es die Erzeugung und Bereitstellung eines synthetischen Peptids bewirken kann, das kovalent an F gebunden ist, so dass dem Peptid T-Zellen in Verbindung von MHC Klasse I Molekülen angeboten wird und die Entwicklung von zytotoxischen CD8+ T-Zellen erzeugt. Im Zusammenhang mit einem wirksamen AIDS-Wirkstoffkönnen verschiedene F-derivatisierte HIV-Hybridpeptide konstruiert werden, umfassend die über eine N-oder C-terminbale, an eine Aminosäuresequenz des HIV-Proteins gekoppelte Aminosäuresequenz (vergl. zum Beispiel Tabelle VII), das in vivo zytotoxische T-Zellen induzieren kann. Beispiele der beschriebenen HIV-Peptide, die von zytotoxischen T-Zellen der HLA Klasse I erkannt werden, sind in Tabelle IX aufgeführt.

Tabelle IX Zytotoxische T-Zellepitope von HIV-Proteinen

Die Sequenznummern für gp120 und gp41 stammen von Ratner et al., Nature, 313: 277-284 (1985). Die Sequenznummern für pol- und gag- roteine stammen von Sciliciano et al. (Cell, 54: 561 C1988)). bzw. Walker et al. (Proc. Natl. Acad: Sci. (USA), 86: 9514 (1989).

a Takahashi et al. Proc. Natl. Acad. Sci. (USA), 85: 3105 (1988).

b Sciliciano et al., Cell, 54: 651 (1988).

c Walker et al., Proc. Natl. Acad. Sci. (USA), 86: 9514 (1989).

d Nixon et al., Nature, 336: 484 (1988).

Letztere Strategie ist insofern wichtig, als zytotoxische T-Zellepitope von spezifischen polymorphen Molekülen der HLA Klasse I oder Klasse II erkannt werden. Liegt nur 1 solches Epitop [eine lineare Peptidsequenz, wie ein (A)-Peptid] im Impfstoff vor, dann würden nur solche Spezies mit dem spezifischen HLA-Antigen, welches das (A)-Peptid zur Präsentierung gegenüber zytotoxischen T-Zellen verwendet, zytotoxische Zellen gegen HIV entwickeln. Wenn jedoch in einem Immunisierungsmittel zahlreiche F-derivatisierte Peptide enthalten sind, von denen jedes in Verbindung mit einem bestimmten HLA Masse I- oder Klasse II-Molekül von zytotoxischen Zellen erkannt werden kann, dann werden Lebewesen mit einem breiten Spektrum von HLA-Typen zytotoxische T-Zellen gegen HIV erzeugen.

Demzufolge enthält ein Immunisierungsmittel, das in der Lage ist, zytotoxische anti- HIV T-Zellen in der Mehrheit der Bevölkerung zu induzieren, vorteilhafterweise ein Gemisch von Peptiden, wovon jedes von einem bestimmten HLA Masse I-Typ (zum Beispiel) erkannt wird, so dass das Gesamtgemisch Peptide einschließt, die immunisierend wirken und von Molekülen des Klasse T-Typs erkannt werden, die insgesamt bei der Mehrheit der Mitglieder einer bestimmten Bevölkerungsgruppe ausgepresst werden. Tabelle IX gibt Beispiele von beschriebenen zytotoxischen T-Zellepitopen und ihrer HLA beschränkenden Elemente, wieder, sofern bekannt. Das sind die Peptidtypen, die durch F-Sequenzen derivatisiert sind und als Gemisch mit F-T1-SP10(A)-Peptiden verwendet werden können. Alternativ können die Sequenzen in Tabelle IX C-terminal an SP10-Sequenzen in F-T1-SP10-Peptiden kovalent gebundden werden, anstatt von (A)-Sequenzen und einem Gemisch aus F-T1-SP10(X)-Peptiden, das als AIDS Impfstoff verwendet wird (in der Formulierung F-T1-SP10(X) ist X entweder ein (A)-Segment (vergl. Tabelle II und VIII) oder eine andere zytotoxische T-Zellen induzierende Sequenz, wie sie in Tabelle IX aufgelistet sind).

Die gleichen Überlegungen bezüglich der MHC-Beschränkung, die für zytotoxische T-Epitope gelten, gelten auch für T-Helferzellen. Das heißt, die Erkennung non Antigenen durch T-Helferzellen wird von der HLA beschränkt und für die Mehrzahl der Mitglieder einer Bevölkerungsgruppe, die auf ein Immunisierungsmittel reagiert und T-Helferzellen erzeugt, müssen für die Ansprechung auf das Immunisierungsmittel ausreichend T-Helferzellenpitope vorliegen, damit darin genügend Varianten von T-Helferzellen verfügbar sind, so dass die T-Zellen in einem jeden Patienten auf Antigene treffen, die in Verbindung mit ihren eigenen HLA Klasse II-Molekülen erzeugt wurden. Tabelle X gibt Helferzellenepitope von HIV- Proteinen an, durch welche die T 1- oder T2-Sequenzen im F-Th-SP10-(X))-Gefüge ersetzt werden können, um alternativ T-Helferzellenepitope im Gefüge bereitzustellen.

Untersuchungen lassen erkennen, dass das gleiche T-Helferzellenepitop in Verbindung mit mannigfachen HLA Klasse II-Spezies von T-Zellen erkannt werden kann, und daher nur wenige T-Helferzellenepitope benötigt werden, um einen wirksamen Impfstoff für AIDS auf der Basis synthetischer Peptide zu formulieren. Clerici et al. (Nature, 339: 383-385 (1989)) haben Daten zur Verfügung gestellt, wonach T-Zellen bei 85% der untersuchten Bevölkerungsgruppen entweder T1 oder T2 T-Helferzellenepitope erkennen konnten (vergl. Tabelle X). Schrier et aL (J. Immunol., 142: 1166-1176 (1989)) haben eine Reihe von T-Helferzellenepitope in HIV-Proteinen identifiziert und gezeigt, dass T-Zellen bei 93% der untersuchten Bevölkerungsgruppen auf mindestens 1 von 4 T-Helferzellenepitope ansprechen (vergl. Tabelle X).

Tabelle X T-Helferzellenepitope in HIV Proteinen

Die Sequenzen der obigen ersten 20 Peptide sind von Schrier et al. (J. Immunol. 142: 1166-1176, 1989) und die Sequenzen T1, T2, Th4 und p18 sind von Clerici et al (Nature, 339: 383-385,1989).

Die erfindungsgemäßen Peptide können in einem Impfstoff verwendet werden, der die allgemeine Struktur und Zusammensetzung von Peptidgemischen der Formulierung

F-Th-SP10(X)

Th-SP10(X)

TH-SP10

und

F(X)

aufweist, worin, wie vorstehend angegeben, F Sequenzen der mutmaßlich fusogenen Domäne von HIV env gp41 (zum Beispiel Aminosäuren 519-530 im HIV-Isolat BH10/IIIB oder homologe Bereiche in anderen HIV-1-, HIV-2- oder SIV-Isolaten oder funktional dazu äquivalente Sequenzen) (vergl. zum Beispiel Tabelle III); Th-Sequenzen die entweder die T1- oder T2- Helferepitope sind oder alternativ irgend eines der in Tabelle X aufgeführten T-Helferzellenepitope oder Aminosäuresequenzen aus anderen Bereichen des HIV-Proteins, die nicht aufgeführt sind, aber als T-Helferepitope fungieren, SP10-ähnliche Sequenzen sind aus den in den Tabellen I, II oder VIII aufgeführten oder aus irgendwelchen, DP10-ähnlichen Sequenzen aus HIV-Feldisolaten (vergl. zum Beispiel LaRosa, G., et al., Science, 249: 932-935 (1990)); und (X)-Sequenzen HIV-Proteinsequenzen sind, die von beschränkt zytotoxischen T-Zellen der MHC Klasse I oder Klase II erkannt werden. Beispiele für (X)-Bereichssequenzen sind in den Tabellen VIII und IX angegeben.

Die genauen Sequenzen, die in den Peptiden T-Th-SP10(X), Th-Sp10(X), Th-SP10 und F(X) enthalten sind und die Anzahl unterschiedlicher Peptide, welche den erfindungsgemäßen AIDS-Impfstoffumfassen, wird von der Anzahl der zytotoxischen T-Zellen und der Wirkung der T-Helferzellen bei der Mehrzahl der Menschen einer bestimmten Bevölkerungsgruppe bestimmt. Der Fachmann wird erkennen, dass die Größe von F, Th, SP10 und (X) schwanken darf, solange die vorstehend angegebene Wirkung eines jeden einzelnen erhalten bleibt. Für die Einführung schützender, neutralisierender anti-HIV Antikörper werden die spezifischen SP10-ähnlichen Sequenzen, die in den F-Th-SP10 (X)-Peptiden vorliegen müssen, von der wechselnden Zahl von HIV-Isolaten in einer gegebenen Bevölkerung zu einem bestimmten Zeitpunkt abhängen. Der Fachmann wird erkennen, dass die Informationen darüber in der Bevölkerung aktiv und laufen überwacht und die Formulierung des AIDS-Impfstoffs in Abhängigkeit der Änderung der vorstehenden Parametern von Zeit zu Zeit geändert werden muss.

Die Einführung schützender, neutralisierender anti-HIV Antikörper in Bevölkerungsgruppen, die eine Reihe unterschiedlicher HIV-Isolate einschließen, kann durch die Verwendung der vorsehend beschriebenen Impfstrategie und/oder durch die Anwendung von wenigstens einer Peptidkonfiguration erfolgen, die eine bewahrende Konformationsdeterminante von gp120 simuliert und so in der Lage ist, in der Breite gegenreaktive anti-HIV Antikörper zu induzieren. Ein solches Strukturelement nimmt die Form eines Mimetops einer Konformationsdeterminante des nativen HIV gp120 C3-V3-Bereichs an und wird durch T1-SP10-CANO (A) (vergl. Tabelle XXIII) veranschaulicht. Während die primäre V3-Sequenz der CANO- Hülle stark von anderen V3-Sequenzen der HIV-Hülle verschieden ist (vergl. wiederum Tabelle XXIII), induziert das T1-SP10CANO (A)-Peptid gegenreaktive anti-V3-Antikörper gegen eine Vielfalt von HIV-Motive (vergl. Beispiel 11). Die Einführung der Gegenreaktivität beruht auf Strukturen sekundärer und höherer Ordnung der V3-Windung des HIVCANO- Isolats, welche zur hybriden T1-SP10CANO (A) C4-V3 Spiegelung einer breiten neutralisierenden Determinante von HIV gp 120 führt. Dies wird durch den Umstand bewiesen, dass der monoklonale anti-gp 120-Antikörper 48d beim Menschen (welcher monoklonale Antikörper bei Mäusen blockiert, welche die Bindung von CD4 an gp120 verhindern, aber selbst die Bindung von gp120-CD4 nicht blockieren (Thali et al., J. Virol., 67: 3978-3988 (1993) T1- SP10CANO (A) binden.

Als alternative Ausführungsform (Strategie) kann ein wirksamer Impfstoff durch die Bestimmung der HLA Klasse I- und Klasse II-Typen für eine bestimmte Person, zum Beispiel entweder durch Kettenreaktionsanalyse mit Polymerase oder durch herkömmliche HLA-Gewebetypanalyse bestimmt werden. Auf der Basis diese Information können die spezifischen Immunisierungsmittel bestimmt werden, die in die F-Th-SP10 (X), Th-SP10 (X) und F (X)-Formulierung inkorporiert werden müssen. Demzufolge sind bei dieser, letzteren Ausführungsform die der Person verabreichten Peptide jene, die zur Induzierung der gewünschten anti-HIV B- und T-Zellwirkung erforderlich sind.

Beim Studium des Vorstehenden wird der Fachmann erkennen, das dies eine allgemeine Strategie für die Entwicklung eines Impfstoffs für beliebige Infektionskrankheiten ist. Darüber hinaus stellt die Fähigkeit zur Konjugation des F-Bereichs des HIV gp41-Hüllenproteins an eine beliebige, von zytotoxischen T-Zellen erkennbare Sequenz (wodurch ein lineares, zur Injektion geeignetes Peptid, geschaffen wird, das von zytotoxischen T-Zellen in Verbindung mit MHC Klasse I-Molekülen erkannt werden kann) eine einfache und wirksame Methode zur Induzierung auf die MHC Klasse beschränkter zytotoxischer T-Zellen in irgendein Peptid bereit, das zytotoxische T-Zellenepitope trägt. Dies ist der Fall, unabhängig davon, ob sich die Sequenz des zytotoxischen T-Zellenepitops von Proteinen in einem befallenen Organismus oder von Wirtsproteinen ableitet.

Als Beispiel für die Verwendung F-derivatisierter Peptide, welche Sequenzen von Wirtsproteinen einschließen, wird angenommen, dass F-derivatisierte Peptide verwendet werden können, umfassend HIV go41 F-Sequenzen (zum Beispiel die Aminosäuren 519-530 des BH10IIIB HIV-1-Isolats oder von homologen Bereichen anderer HIV-1-, HIV-2- oder SIV- Bereiche, oder dazu funktional gleichwertige Sequenzen), die entweder N- oder C-terminal an Peptide konjugiert sind, die von zytotoxischen T-Zellen in Verbindung mit MHC Klasse I oder Klasse II erkannt werden können, wobei die Sequenzen solcher Peptide, die vom variablen Bereich des T-Zellenrezeptors für Antigene (TCR) Moleküle abgeleitet werden, auf deren Oberfläche autoreaktiver T-Zellen ausgepresst sind, welche die Zerstörung des Wirtsgewebes bei verschiedenen selbstimmunisierenden Krankheiten, Infektionskrankheiten und bei der Anbindung von Organtransplantationen vermitteln. 999999999999

Sun et al. (Nature, 332: 843 (1988); Eur. J. Immunol., 18: 1993 (1988) haben über die Isolierung zytotoxischer T-Zellklone berichtet, die idiotypische Determinanten auf enzephalltogenen T-Zellen sind und die eine angenommene Resistenz auf experimentelle, selbstimmunisierende Enzephalomyelitis übertragen. Das Konzept der Immunisierung von Personen mit selbstimmunisierenden Krankheiten mit Immunisierungsmitteln, die eine Immunisierungswirkung gegen selbstimmunisierende T-Zellklone induzieren, wurde neuerdings als ein wichtiger experimenteller Ansatz erkannt (besprochen bei Cohen et ab, Immunol. Today, 332 (1988); Howell et al., Science, 246: 668, (1989); Wralth et al., Cell, 57: 709 (1989)). Die vorliegende Erfindung stellt demzufolge ein einfaches und wirksames Verfahren zur Einführung von beschränkt zytotoxischen T-Zellen der MHC Klasse I oder Klasse II in Peptide von Wirtsantigene bereit, und stellt demzufolge einen beachtlichen Fortschritt bei der Entwicklung von Impfstoffen für selbstimmunisierende Krankheiten dar.

Bei Verwendung von Standard DNA Rekombinanttechniken und vorhandenen Mustern und Sequenzen von Antigenbindungsbereichen des TCR-Moleküls können Sequenzen aus einzelnen Bereichen von TCR-Molekülen erhalten werden (Barns et al., J, Exp. Med., 169: 27 (1989)). F-derivatisierte Peptide können dazu verwendet werden eine zytotoxische Immunisierungswirkung in T-Zellen einzuführen, die auf spezifische Klone von T-Zellen, welche CTRs tragen, die für die von antigenspezifischen T-Zellen übertragenen Schäden des Wirtsgewebes bei den vorstehenden Kategorien von Krankheiten verantwortlich sind, ausgelegt sind. Einmal eingeführt kann eine solche, von einem F-Peptid induzierte, auf anti-TCR ausgerichtete zytotoxische T-Zellenwirkung, die autoreaktiven Klone oder T-Zellen beseitigen und dadurch eine neune, hochspezifische Strategie zur Kontrolle der durch T-Zellen vermittelten Gewebezerstörung, bereitstellen.

Ein zweites Beispiel für die Verwendung F-derivatisierter Wirtspeptide besteht darin, die durch Antikörper vermittelte Gewebezerstörung auf ähnliche Weise zu kontrollieren, wie sie im Zusammenhang mit selbstimmunisierenden Krankheiten, Infektionskrankheiten und bei der Anbindung bei Organtransplantationen auftreten. Die Antigenrezeptoren auf der B-Zelloberfläche (Oberflächenimmunoglobulin) enthält Bereiche, die Antikörper-bildende Klone von B-Zellen spezifisch sind. Durch die Identifizierung der Antikörper-bildenden Klone von B-Zellen, die für die gewebespezifischen Schäden bei den vorstehenden Kategorien von Krankheiten verantwortlich sind, kann die Sequenz der Peptide aus dem Beeich des B-Zellen Immunoglobulins, welches das Antigen bindet, durch Verwendung von zum Beispiel rekombinanten DNA-Verfahren, identifiziert werden. Des Weiteren können Sequenzen, die zytotoxische T- Zellwirkungen der MHC Klasse I oder Klasse II auszulösen können, identifiziert werden.

Durch die Derivatiserung eines solchen Peptids mit einem Immunoglobulin als Antigenanbindungsbereich mit F-Sequenzen und Injizieren des F-derivatisierten Peptids in eine Antikörper bildende Person, kann eine zytotoxische Zellwirkung gegen eine selbsttätig Antikörper erzeugende B-Zelle induziert werden, wodurch eine gewebeschädigende Autoantikörperwirkung beseitigt wird, wie sie im Zusammenhang mit den vorstehenden Kategorien von Krankheiten auftritt.

Ein drittes Beispiel für die Verwendung F-derivatisierter nicht-HIV-Poteine besteht in der Anwendung der vorstehend beschriebenen Grundsätze auf die spezifische Beseitigung von autoreaktiven Arten von T- und B-Zellen zur Behandlung erkrankter klonaler B- und T-Zellen, die auf ihrer Oberfläche klonale Immunoglobuline oder TCR-Moleküle auspressen. Es wurden therapeutische Anti-Tumor-Strategien beschrieben, die Antikörper gegen unterschiedliche Bereiche von entweder Immunoglobulinmolekülen auf der Oberfläche von B-Zellen (Hamblin et al., Cancer, 42: 495 (1980); Miller et al., N. Engl. J. Med., 306: 517 (1982)) oder Antikörper gegen unterschiedliche TCR-Bereiche bei der Behandlung von T-Zelltumoren (Kanagawa, O., J. Exp. Med., 170: 1513 (1989)) anwenden. F-derivatisierte synthetische Peptide, welche die Sequenzen unterschiedlicher Bereiche von TCR- oder Immunoglobulinmolekülen enthalten, die auf der Oberfläche, insbesondere kranker, T- oder B-Zellen ausgepresst sind, können in vom Krebs befallene Wirte injiziert werden, um anti-TCR- oder anti-Immunoglobulin spezifische Wirkungen in zytotoxischen T-Zellen zu induzieren, welche die Krebszellen abtöten.

Ein viertes Beispiel für die Verwendung F-derivatisierter, nicht-HIV-Proteine, ist die Schaffung eines Immunisierungsmittels, welches pathogen inhibierte Zellen abtötet und so die Beseitigung pathogen infizierter Zellen aus dem Wirt erleichtert. Hepatitis C (nicht Hepatitis A oder B) ist beispielsweise ein Krankheit, welche durch die Übertagung viraler Teilchen in Zellen oder im Serum von einer Person auf eine andere verursacht wird. Durch die F-Derivatisierung von Sequenzen zytotoxischer T-Zellenepitope auf das Hepatitis C-Virusprotein und die Injizierung solcher Sequenzen in Personen, können gespeicherte anti-Hepatitis C-Wirkungen spezifischer zytotoxischer T-Zellen induziert werden, welche die Person vor der Infektion mit lebenden Hepatitis C-Viren schützen, indem sie einen neuartigen Hepatitis C-Impfstoff bereitstellen. Eine solche Strategie kann auch verwendet werden, um einen Impfstoff für andere Infektionskrankheiten zu schaffen.

Die folgenden Beispiele veranschaulichen die Erfindung in größerem Detail, ohne sie zu beschränken.

Beispiel 1 Synthese von Peptiden und Darstellung von Konjugaten

Im Wesentlichen reine synthetische Peptide, die hydrophile Aminosäuresequenzen des HTLVIIIB-Hüllengycoproteins gp120 (Ratner et al., Nature, 313: 277 (1985)) enthalten, wurden auf einem Applied Biosystems 430A Peptidesynthesizer unter Verwendung der vom Hersteller gelieferten chemischen und Programmzyklen synthetisiert. Die Sequenzen der synthetischen Peptide sind in Tabelle XI aufgeführt.

Tabelle XI

Synthetische Peptide mit hydrophilen Aminosäuresequenzen des HTLV-III Hüllenproteins

a) Nach Ratner et al., Nature, 313: 277 (1985).

b) Die Aminosäuren in Klammern wurden zur Iodierung des Peptids (Y) und Kopplung an das Trägerprotein (C) zugegeben.

Der Zusammenhang zwischen den synthetischen Peptiden und den bekannten rekombinanten Proteinen PE3, PBI und PENV9 ist in Fig. 1 dargestellt (Putney et al., Science, 234: 1392 (1986); Petteway et al., Viruses and Human Cancer: UCLA Symposia on Molecular and Cellular Biology, 1987).

Die Peptide wurden mit MBS an Trägermoleküle, wie Rinderserumalbumin (BSA) oder Tetanus-Toxoid (TT) konjugiert, wie von Green et al. (Cell, 28: 477 (1982)) und Palker et al. (Proc. Natl. Acad. Sci. (USA), 84: 2479 (1982)) beschrieben. Für die Kopplung wurden zum Beispiel 24 mg Tetanus-Toxoid in 0,5 ml phosphatgepufferter Kochsalzlösung, pH 7,2, mit 1 mg MBS in 100 ul Dimethylformamid eine Stunde bei 23ºC inkubiert. Anschließend wurde das mit MBS behandelte Tetanus-Toxoid der Siebohromatographie an einer PD-10-Säule (Pharmacia) unterworfen und das nicht umgesetzte MBS vom TT-MBS abgetrennt und die TT-MBS enthaltenden Fraktionen im leeren Säulenvolumen mit Hilfe der spektrophotometrischen Messung der optischen Dichte bei 280 nm zurückgewonnen. TT-MBS wurde dann durch 3 h Schütteln bei 23ºC mit 6-9 mg synthetischem Peptid (Molverhältnis Peptid zu Trägerprotein 30: 1) in PBS-haltigem Cystein entweder am Carboxyl- oder am Aminoterminus inkubiert. Die TT-Peptidkonjugate wurden über Nacht bei 4ºC gegen PBS dialysiert oder nochmals an einer PD-10-Säule entsalzt und als Immunisierungsmittel verwendet.

Die Konjugation der Peptide an BSA oder Tetanus-Toxoid wurde dadurch überwacht, dass die Konjugate der Natriumdodecylsulfat-Polyacrylamid-Gelelektrophorese (SDS-PAGE) unter nicht reduzierenden Bedingungen unterworfen wurden, sowie durch Messung der Zunahme des scheinbaren Molekulargewichts gegenüber demjenigen von MBS-behandelten BSA und TT. Der durch Spureniodierung der Peptide überwachte Konjugationsgrad, schwankte je nach Peptid zwischen 10 und 30%.

Beispiel 2 Reaktivität von Antikörpern von AIDS-Patienten auf synthetische Peptide.

Es wurden synthetische Peptide, abgeleitet von an BSA gekoppelte, hydrophile Bereiche von gp120, als Antigene bei einem Radioimmunisierungsversuch (RIA) mit Seren von HIV+-Patienten (N = 12) und normale Serumkontrollproben (N = 4) verwendet, um das Ansprechen der Antikörper von AIDS-Patienten auf die Epitope auf gp120 zu untersuchen (Fig. 2) (Palker et al., J. Immunol., 136: 2393 (1986); ibid. Proc. Natl. Acad. Sci. (USA), 84: 2479 (1987)). Die meisten Seren von HIV+-Patienten reagierten mit zwei synthetischen Peptiden, SP10 (9/12, 75%) und SP22 (8/12, 67%).

Die Ergebnisse sind als Verhältnis (E/C) doppelter cpm-Werte ausgedrückt, die mit experimentellen AIDS-Seren (E) und Proben von Kontrollseren (C) erhalten wurden. E/C > 3,0 = positiv.

Beispiel 3 Reaktivität von an synthetischen Peptidaffinitätssäulen gereinigten 120 Antikörpern von HIV+-Patienten.

Zur Preparierung der Affinitätssäulen wurden synthetische Peptide, die Aminosäuresequenzen von HTLVIIIB gp120 (SP10, 11A, 11, 14, 15, 22 (vergl. Fig. 1) enthielten, an BSA gekoppelt und anschließend kovalent an CNBr-aktivierte Sepharose gebunden. Serumanteile (2 ml) von HIV serumpositven Patienten wurden dann durch jede Säule gegeben und die Antikörper, die sich an die Affinitätsäulen banden, wurden anschließend auf ihre Reaktionsfähigkeit an gereingten, mit ¹²&sup5;I-markierten HTLVIII gp120 im RIP-Versuch (Fig. 3A) und auf ihre Reaktionsfähigkeit gegenüber der Oberfläche von HTLVIIIB infizierten H9-Zellen im direkten Immunofusionsversuch (Fig. 3B) geprüft.

A) Beim RIP-Versuch (Palker et al., Prod. Natl. Acad. Sci. (USA), 84: 2479 (1987); ibid., J, Immunol., 136: 2393 (1986)) gebundene Antikörper von der SP10 (Säule 1), SP10A (Säule 2), SP11 (Säule 3) und SP22 (Säule 6) Affnitätssäulen reagierten mit gp120-IIIB beim RIP-Versuch, wobei Antikörper von der SP10-Säule die größte Reaktionsfähigkeit gegenüber gp 120-IIIB aufwiesen.

B) Bei der Prüfung mittels FACS Analyse (Shapiro, Practiced Flow Cytometry Alan R. Liss Pub., NY, NY, 1985) banden sich gegenüber dem synthetischen Peptid SP10 reaktive Antikörper an die Oberfläche von HIV-infizierten Zellen, während eine Bindung affinitätsgereinigter Antikörper an SP14 oder SP10A, 11, 15 oder 22 (nicht dargestellt) nicht festgestellt wurde. Diese Werte lassen vermuten, dass die durch SP10 definierten antigene(n) Stelle(n) zur Bindung an Antikörper befähigt ist(sind), wenn auf der Oberfläche von HIV+- Zellen gp120 vorliegt.

Beispiel 4 Neutralisation von HIV durch Ziegen-anti-SP10 Antiserum

Ziegen wurden subcutan mit 28 mg SP10 Tetanus-Toxoid-Konjugaten (SP10-TT) in Freunds Komplettadjuvans immunisiert (Tag 0) und anschließend alle zwei Wochen in Freunds unvollständigem Adjuvans (Tag 14 und 28) geimpft. Nach der zweiten Immunisierung wurden Proben gesammelt und auf ihre Fähigkeit geprüft, die HIV-Infektion von H9- T-Zellen in vitro zu inhibieren (d. h. zu neutralisieren), gemessen anhand des Vorliegens der RNS-abhängigen DNS-Polymeraseaktivität (RT) in den Überständen der Zellkulturen (Fig. 4). Die bei den RT- Versuchen erhaltenen, abnehmenden cpm-Werte spiegeln abnehmende HIV-Niveaus nach der gemeinsamen Züchtung des Virus und der Zellen während 10 Tage wieder.

Wurde das Ziegen-anti-SP10 Antiserum mit 100 Infektionseinheiten HTLVIIIB vorinkubiert, neutralisierte es die Fähigkeit des HIV-Isolats HTLV-IIIB H9-T-Zellen zu infizieren ( - , 50% Neutralisationstiter = 1/145). Im Gegensatz dazu neutralisierte Serum, das von der gleichen Ziege vor der Immunisierung gesammelt worden war, HTLVIHB nicht nennenswert (o-o, 50% Neutralisationstiter = 1/16).

Das mit SP10-TT gespritzte Originaltier (dessen Serum HTLVIIIB beim reversen Transcriptaseversuch neutralisierte) wurde anschließend mit zusätzlichen Dosen SP10-TT (0,5 mg/kg Körpergewicht) gespritzt. Der 50% Neutralisationstiter stieg nach der zweiten Injektion auf 1 : 1600. Die Neutralisationswerte dieses und anderer Versuche mit SP10-ähnlichen Peptiden sind in Tabelle XII als Serumverdünnung angegeben, die eher zu einer 80% Neutralisation als zu einer 50% Neutralisation von HIV führen.

Zusätzlich wurden einer zweiten Ziege zweimal Dosen von 0,5 mg/kg SP10-TT injiziert. Das Serum der zweiten Ziege neutralisierte HTLVIIIB bei einem Titer von 1 : 100. Es ist wichtig, dass beide gegen SP10-TT in Ziegen gezüchtete Seren auch die HTLVTIIB- Infizierbarkeit von T-Zellen beim Synzytiuminhibierungsversuch inhibieren (Tabelle XII).

Der Synzytiuminhibierungsversuch (Lifson et al., Nature, 323: 725 (1986)) misst die Fähigkeit von Antikörpern die Fusion HIV-infizierter T-Zellen, jene die das HIV gp120 Hüllenprotein auf der Zelloberflßäche auspressen, mit CD4 (T4)+ nicht infizierten T-Zellen zu inhibieren. Das CD4 (T4)-Molekül dient als Rezeptor für den AIDS Virus (Maddon et aL, Cell, 47: 333 (1986)). Das Ergebnis der Fusion dieser beiden Zellsorten ist die Bildung von Riesenzellen, die mit HIV infiziert sind. In vielen Fällen führt die HIV-Infektion von Zellen und die Bildung von Riesenzellen zum Tod der infizierten Zellen (Zagary et al., Science, 231: 850 (1986)).

Tabelle XII

Einfluss von anti-SP10 Antiseren auf die Infizierbarkeit der HIV-Isolate HTLVIIIB, HTLVIIIRF und HTLVIIIMN

1) Die synthetischen Peptide wurden mit m-Maleimidobenzoyl-N-hydroxysuccinimdester (HDS) an Tetanus-Toxoid (TT) gekoppelt. SP10 RF(A)-CRKSITKGPGRVIY; SP10 IIIB(C): CTRKSIRIQRGPGRY:

2) Die Werte in Klammern sind die Kehrwerte der Serumverdünnungen, welche die Synzytiazahl (60-80) pro Kalotte inhibierten.

3) Die Neutralisation wurde durch Auswertung der reverse Transcriptaseaktivität in den Überständen von H9-Zellen bestimmt, die 10 Tage in Gegenwart von 100 Infektionseinheiten der HIV-Isolate gezüchtet worden waren. Die Werte sind die Kehrwerte der anti-Serumverdünnungen, welche die reverse Transcriptaseaktivität um > 80% inhibierten.

Die vorstehend beschriebene Fähigkeit des Ziegen-anti-SP10-Serums die Infizierbarkeit von HTLVIIIB beim Synzytiumversuch und beim reversenv Transcriptasversuch zu inhibieren, zeigt daher an, dass anti-SP10 Antikörper in der Lage sind, die Bindung von HIV gp120-Protein an CD4 (T4)-Moleküle von T-Zellen zu blockieren. Zusätzlich inhibierte Ziegen-Antiserum, das auf einem Peptid [SP10 RF(A)] gezüchtet worden war, welches die SP10- ähnliche Sequenz des HIV-Isolats HTLVIIIRF enthielt, die Synzytiumbildung durch HTLV- IIIRF, nicht aber durch HTLVIIIB, was anzeigt, dass in SP10 RF(A) enthaltene typspezifische Antikörper als Bestandteil von Impfstoffen geeignet sind, Antikörper zu induzieren, welche die Wechselwirkung von HTLVIIIRF gp120 mit CD4 (T4)-Molekülen von T-Zellen unterbinden.

Beispiel 5 Induzierung von Antikörpern zur Inhibierung der HIV gp120 - CD4 (T4)-Wechselwirkung.

Es wurde eine Reihe von Untersuchungen durchgeführt, um festzustellen, ob 1) das SP10-Peptid, entweder an Rinderalbumin oder Tetanus-Toxoid gebunden, irgendeinen inhibierenden Einfluss auf antigenspezifische DC4 (T4)-abhängige T-Zellwirkungen in vitro ausübt; und ob 2) das in Beispiel 4 beschriebene anti-SP10-Antiserum, an Populationen von menschlichen weißen Blutzellen gebunden, nicht mit HIV infiziert wird.

Wurde das SP10-Peptid in vitro nicht infizierten Kulturen menschlicher, peripherer Blutlymphozyten zugesetzt, die mit Tetanus-Toxoid stimuliert waren, wurde keine Inhibierung der normalen T-Zellreaktion auf Tetanus-Toxoid beobachtet (Tabelle XLII).

Wie aus Tabelle XIII hervorgeht, war SP10-TT allein ein ebenso guter antigenspezifischer T-Zellaktivator wie TT allein. Darüber hinaus inhibierten SP10-TT- und Sp10-BSA- Zusätze zu TT allein die TT-induzierte Vermehrung normaler T-Zellen nicht. Zusätzlich verband sich anti-SP10-Ziegenserum nicht mit peripheren Lymphozyten oder Monozyten des Blutes beim indirekten Immunofluoreszenzversuch unter Verwendung der Durchßusszytofluorometrie.

Tabelle XIII

SP10-TT und SP10-BSA inhibierten antigenspezifische Wucherungen normaler menschlicher, peripherer Blutlymphozynten nicht.

TT = Tetauns-Toxoid (Wyeth Laboratories, Philadelphia, Pa.).

BSA = Rinderserumalbumin

CPM = Signale pro Minute bei der Inkorporierung von Tritium-markiertem Thymidin, wie beschrieben (Denning et al., J. Immunol., 138: 680 (1987)).

Diese Werte zeigen, dass das SP10-Peptid die auf einem funktionalen CD4 (T4)-Molekül beruhende, normale menschliche T-Zellenfunktion nicht stört, aber Antikörper induziert, welche die HIV gp120- CD4 (T4)-Wechselwirkung inhibieren und HIV beim Transcriptaseinhibierungsversuch neutralisieren.

Demzufolge weisen Impfstoffe, welche die kleinen synthetischen SP10-ähnlichen Peptide umfassen (weniger oder gleich etwa 35 Aminosäuren der Länge nach) ausgeprägte Vorteile gegenüber HIV-Impfstoffen auf, welche rekombinantes gp120 oder größere Teilbereiche davon aufweisen, da letzteres die normale Immunfunktion stören kann.

Beispiel 6 Isolat-spezifische Neutralisation von HIV

Das synthetische Peptid SP10 besitzt eine Aminosäuresequenz, die sich vom gp120- Hüllenprotein der HIV-Isolate HTLVIIIB und LAV ableitet und einzigartig ist, während andere HIV-Isolate unterschiedliche Aminosäuresequenzen in ihren SP10-ähnlichen gp120- Hüllenproteinen aufweisen. Das synthetische Peptid SP10 (d. h. SP10IIIB) aus dem HTLV- IIIB-Isolat von HIV wurde an Tetanus-Toxoid gekoppelt und dazu verwendet Ziegen-Antikörper zu züchten (0,5 mg Konjugat pro kg Ziege Körpergewicht), wie von Palker et al., (Proc. Natl. Acad. Sci., (USA), 84: 2479 (1987)) beschrieben. Ziegen-Antikörper, die zum synthetischen Peptid SP10 gezüchtet worden waren, wurden auf ihre Fähigkeit zur Neutralisation von vier unterschiedlichen HIV-Isolaten (Fig. 5A: HTLIIIB, Fig. 5B: HTLVIIIRF, Figur %C: HTLVIIIMN, Fig. 5D: HTLVIIISC) geprüft. Ziegen anti-SP10 Antiserum (0, Premun- Ziegenserum (0) und Aids-Patienten Serum ( ) mit jeweils 1/10 Verdünnung wurden zuerst mit Verdünnungen (10&supmin;¹, 10&supmin;², 10&supmin;³) von jedem Virusisolat inkubiert. Als Nächstes wurden diese Virusisolate auf ihre Fähigkeit H9-T-Zellen zu infizieren durch gemeinsame Züchtung von Virus und Zellen während 10 Tage in vitro geprüft. Die in den Überständen der Zellkulturen nach 10 Tagen Züchtung vorliegenden HIV-Spiegel wurden durch Messung der RT- Aktivität in den Überständen abgeschätzt und die Ergebnisse sind in Form der beim RT- Versuch angefallenen cpm-Werte ausgedrückt. Steigende cpm-Werte beim RT-Versuch spiegeln zunehmende HIV-Niveaus in den Kulturen wieder.

Wie in Fig. 5A gezeigt, inhibieren Ziegen-anti-SP10 Antiseren (d. h. neutraliserte) die HTLVIIIB-Infektion von H9-Zellen bei einer Virusverdünnung von 10&supmin;². Premium-Ziegenserum inhibierte die HTLVIIIB-Infektion bei der gleichen Verdünnung nicht. Im Gegensatz dazu neutralisierte Ziegen-anti-SP10 Antiserum andere HIV-Isolate nicht (Fig. 5B-D). Antikörper von AIDS-Patienten neutralisieren alle vier Isolate (Fig. 5A-D). Die Werte zeigen, dass Ziegenantiserum zusätzlich zu synthetischem Peptid SP10 das HTLVIIIB-Isolat neutralisiert, das in seinem gp120-Hüllenprotein die in SP10 vorliegende Aminosäuresequenz enthält. Diese Werte lassen zusammen mit den Daten in Tabelle XII den Schluss zu, dass ein Impfstoff, der SP10-ähnliche Aminosäuresequenzen aus einer Vielzahl von HIV-Isolaten enthält, gegenüber einem breiten Spektrum von HIV-Isolaten wirksam sein wird.

Beispiel 7 Bindung von Ziegen anti-SP10-Serum an HTLVIIIB-, aber nicht an HTLVIIIRF-infizierte H9-T-Zellen.

Die Reaktionsfähigkeit von Ziegen anti-SP10-Serum und dem autologen Preblut-Kontrollserum wurden entweder anhand nicht infizierter H9-T-Zellen, mit dem HIV-Isolat HTLV- IIIB infizierter H9-T-Zellen, oder mit dem HIV-Isolat HTLVIIIRF isolierter H9-T-Zellen unter Verwendung der Durchflusszytometrie und einem Coulter EPICS V Cytofluorograph verglichen (Haynes et al., New. Eng. J. Med., 304: 319 (1981)).

Ziegen anti-SP10 Serum (1 : 200) reagierte mit 40% der mit HTLVIIIB infizierten H9- T-Zellen, verglichen mit HTLVIIIB infizierten H9-Zellen, die mit Ziegen-(Preblut)-Kontroll serum (1 : 200) inkubiert worden waren (Fig. 6B). Weder das Ziegen anti-SP10 noch das (Preblut)-Kontrollserum (1 : 50) reagierte mit nicht infizierten H9-T-Zellen (Fig. 6B). Weder das (Preblut)-Kontrollserum noch das anti-SP10 Serum (1 : 50) verband sich mit H9-T-Zellen, die mit dem HIV-Isolat HTLVIIIRF infiziert worden waren (Fig. 6C).

Beispiel 8 Entwicklung eines synthetischen Immunisierungsmittels, umfassend Mehrfachbereiche der Hülle des menschlichen Immunschwächevirus, das neutralisierende Wirkungen gegen T- Helferzellen, zytotoxische CD8+-Zellen und B-Zellen in vivo induziert.

Um ein Immunisierungsmittel auf der Basis eines synthetischen Peptids zu entwickeln, das zusätzlich zur Induzierung von Antikörpern und T-Helferzellwirkungen, zytotoxische T- Zellwirkung auf HIV induziert, wurden eine Reihe von Peptiden bereitet, die Bereiche des HIV-Isloats MN wiederspiegeln, die darin ein definiert zytotoxisches T-Zellenpitop eingeschlossen haben (Tabelle III). Diese Untersuchungen wurden mit dem HIV-Isolat MN durchgeführt, weil dieses offensichtlich der zur Zeit in USA am weitesten verbreitete Virusprototyp ist (Lakosa et al., Science, 249: 932 (1990)).

Takahashi et al. (Science, 246: 116 (1089)) haben ein zytotoxisches T-Zellenepitop (CTL) definiert, das die Aminosäuren 322-326 (FYTTK) aus dem HIV-Isolat MN einschließt und die Aminosäuren 323-329 des Isolats HIVIIIB (vergl. Tabelle IV) (Takahashi et al., J. Exp. Med., 170: 2023 (1989)). Folglich war eine der hergestellten T1-SP10 Peptidvarianten das Peptid T1-SP10MN(A), wobei das (A) darauf hinweist, dass die Aminosäuren 322-326 an den bestehenden MN SP10-Bereich mit den Aminosäuren 303-321 addiert wurden (vergl. Tabelle III). Um zweitens ein synthetisches Peptid herzustellen, das sich in die Zellmembran Antigen-liefernder Zellen einschieben könnte und daher möglicherweise hergestellt und über MHC Klasse I-Molekül ausgepresst und daher von CD8+ CTL erkannt wird, sind die ersten 12 Aminosäuren des Hüllenproteins gp41 (Aminosäuren 5919-530 AVGIGALFLGFL im HIV- Isolat BH10/IIIB) N-terminal kovalent an das T1-SP10-Peptid gebunden. Die Aminosäuren (519-530) von HIV gp41 sind stark hydrophob. Es wurde postuliert, dass dies primäre Aminosäuren sind, die sich in Lipidmembrane einschieben können und eine Rolle bei der Fähigkeit von HIV zur Induzierung der Zellfusion spielen (Brasseur et al., AIDS Res. Hum. Retrovirol., 4: 83 (1988)). Peptide, mit dieser 12 Aminosäuren umfassenden gp41-Sequenz tragen die Vorsilbe F- vor dem Peptidnamen (F steht für fusogener Bereich) (vergl. Tabellen III und IV). Bosch et al. (Science, 244: 644 (1989)) haben gezeigt, dass der zum F-Bereich in HIV (AVGIGALFLGFL) homologe Bereich in SIV (GVFVLGFLGFLATAG) tatsächlich das SIV- Fusionshüllenpeptid ist. Folglich wurde postuliert, dass F-derivatisierte Peptide sich auch in Antigen-liefernde Zellmembranen einschieben könnten, wobei das F-derivatisierte CTL der CD8+ MHC Klasse I im Anschluss and die Immunisierung mit F-derivatisierten Peptiden in vivo erzeugt würden. Deres et al. (Nature, 342: 561 (1989)) haben gezeigt, dass die Konjugation der Fettsäureeinheit Tripalmitoyl-S-glycerylcysteinserin an ein synthetisches Peptid die Herstellung des synthetischen Peptids und das Vorhandensein im Zusammenhang von MHC- Molekülen der Klasse I fördern kann und zur Erzeugung von CD8+ CTL in vivo führt.

Es wurde eine Reihe von Untersuchungen an Balb/c-Mäusen mit den MN-Reihen von T1-SP10-Peptiden (Tabelle III) durchgeführt, um ihre Fähigkeit zur Induzierung von anti- Peptid Antikörpern (vergl. Fig. 7) zu vergleichen, ihre Fähigkeit zur Induzierung neutralisierender anti-HIV Antikörper (Fig. 8) zu vergleichen und festzustellen, ob eines dieser Peptide bei der Injektion in Mäuse in vivo (Tabelle XIV und XV) beschränkte CD8 CTL der MHC Klasse I induzieren könnte.

Tabelle XIV

Fähigkeit des F-T1-SP10MN(A)-Peptids zur Induzierung beschränkt zytotoxischer CD8+ T-Zellen der MHC Klasse I in vivo in Balb/c-Mäusen.

Lösliche F-T1-SP10 A)-Peptide (10 ug) in PBS wurden subcutan in Balb/c-Mäuse in Freunds Komplettadjuvans (1. Injektion) und dann in Freunds unvollständigem Adjuvans (2. bis 5 Injektion) injiziert.

Effektorzellen bestanden aus Splenozyten immunisierter Tiere, die während 7 Tage in vitro mit 25 ug/ml F-T1-SP10MN (A)-Peptid in T-Komplettzellmedium gezüchtet worden waren.

(Takahashi et al., J. Exp. Med, 170: 2023 (1989)). Am 3. Tag der Züchtung wurde 10% Vol./Vol. Con. A Überstand zugegeben. Con. A Überstand wurde von Balb/c Spleenzellen abgeleitet, die 4 Tage mit 10 ug/ml Concanavalin A in T-Komplettzellmedium stimuliert (Takahashi et al., J. Exp,. Med., 170: 2023 (1989)), und die Überstände entfernt und zur Aktivierung zytotoxischer T- Spleenzellen verwendet worden waren.

* Versuche mit der Ergänzung (C) geben die Ergebnisse von gesammelten Splenocyten von 3 mit F-T1-SP10MN(A) immunisierten Mäusen wieder.

Tabelle XV

Fähigkeit von T1-SP10MN(A)-Peptid in Liposome zur Induzierung beschränkt CD8+ zytotoxischer T-Zellen der MHC Klasse I in vivo in Balb/c Mäusen.

Liposome wurden nach Standardmethoden (Mimms et al., Biochemistry 20: 833 (1981); Liposomes Technology Band III, Ed. G. Gregoriadis, Kap. 14, S. 205-224 (1984) unter Verwendung von Octylglucosid 7% (0,7g/10 ml PBS), L-alpha-Dioleyllecithin 20 mg/ml, T1-SP10MN(A)- Peptid und Cholesterin 3,1 mg/ml hergestellt

T1-SP10MN(A)-Peptid enthaltende Liposome wurden in einer Gesamtdosis von 10 ug T1-SP10- MN(A)-Peptid in Liposomen in Freunds Komplettadjuvans (1. Dosis) und anschließend in Freunds unvollständigem Adjuvans (2. bis 5. Dosis) an 2 Stellen subcutan in Balb/c Mäuse injiziert. Die Effektorzellen bestanden in Splenozyten immunisierter Tiere, die wie in Tabelle XI beschrieben, hergestellt und dargestellt wurden.

*) Versuch 1 verwendet RL-12 Zielzellen und Vers. 2 verwendet EL4-Zielzellen.

Vergleich der Fähigkeit verschiedener T1-SP10-Peptide zur Induzierung von anti-Peptid Antikörpern in Balb/c Mäusen

Fig. 7 zeigt eine Vergleich der Siegel von anti-Peptid Antikörpern, die im Serum von Balb/c Mäusen nach 1, 2 und 3 Immunisierungen mit 10 ug/ml verschiedener Peptide erzeugt wurden. Fig. 7 zeigt, dass nach der zweiten Immunisierung, sowohl durch Zugabe des (A)- Bereichs als auch des F-Bereichs der Spiegel der anti-Peptid Antikörper gegenüber dem T1- SP10 MN-Peptid beim ELISA-Versuch zunahm.

Vergleich der Fähigkeit verschiedener T1-SP10-Peptide zur Induzierung neutralisierender anti-HIV Antikörper in Balb/c Mäusen.

Fig. 8 zeigt die prozentuale HIV Synzytiumbildung in vitro, wenn Antiseren aus der Blutabnahme 3 zu einem HIV Synzytiumversuch zugegeben werden. Während nur 1 Tier in der mit F-T1-SP10 gespritzten Gruppe und keines der Tiere der F-T1-Sp10- und T1-SP10(A)- Gruppe Serum-Antikörper aufwies, welche die Synzytiumbildung zu mehr als 50% inhibiert haben, wiesen 3 von 5 Tieren der mit F-T1-SP010MN(A) gespritzten Tiergruppe Antikörperspiegel auf, welche die Synzytiumbildung zu mehr als 50% inhibierten (Fig. 8).

Fähigkeit verschiedener T1-SP10-Peptide zur Induzierung von CD8+ CTL in vivo.

Bei der Injektion in Balb/c Mäuse induzierte weder das T1-SP10 MN- noch das F-T1- SP10 MN-Peptid messbare CTL in Balb/c Mäusen. Lösliche F-T1-SPMN(A)-Peptide (Tabelle XIV) und T1-SP10MN(A)-Peptide in Liposomen (Tabelle XV) konnten jedoch bei der Injektion in vivo anti-HIV CTL in Balb/c Mäusen induzieren, die mit T1-SP10MN(A) beschichtete D'Zielzellen in vivo abtöteten. Tabelle XIV zeigt, dass die durch das lösliche F-T1-SP10- MN(A)-Peptid in vivo in den zytotoxischen T-Zellen von Balb/c Mäusen induzierten zytotoxischen Zellen aus Thy1+, Ly2 (CD8)+ bestanden. Die zytotoxischen T-Zellen CD8+ anti-T1- SP10(A) töteten nur die H2d-Ziele, nicht jedoch H2b-Ziele ab. Tabelle 15 zeigt, dass die durch T1-SP10(A)-Peptide in Liposomen induzierten zytotoxischen T-Zellen aus beschränkten CD8+ der MHC der Klasse I bestanden.

Durch Zugabe der F-Sequenz und der (A)-Sequenz (Tabelle III) zur T1-SP10 MN-Sequenz war es folglich möglich ein Peptid aus 52 Aminosäuren zu konstruieren [F-T1-SP010- MN(A)], das nicht nur neutralisierende Antikörper und T-Helferzellenwirkungen induzieren konnte, sondern ebenso beschränkt zytrotoxische T-Zellen CD8+ anti-HIV der MHC Klasse I induzieren konnte. Darüber hinaus wurden anti-HIV beschränkt zytotoxische T-Zellen der MHC Klasse I durch ein 40 Aminosäuren umfassendes, in Liposomen enthaltenes, T1-SP10-MN(A)- Peptid in vivo induziert.

Beispiel 9

Wie gezeigt worden ist, dient die Konstruktion des synthetischen Peptids T1-SP10(A), welches die aa 303-327 der HIV gp120 V3-Windung [SP10(A)] und die aa 428-443 von HIV gp120 (T1) enthält, als ein wirksames T-Zellen Immunisierungsmittel zur Aktivitätsinduzierung von anti-HIV Memory-T-Helferzellen und als B-Zellen Immunisierungsmittel für anti-HIV neutralisierende Antikörper in vivo (Palker, et al., PNAS (USA), 85: 1932-1936 (1988); Palker et al., J. Immunol., 142: 3612-3619 (1989); Hart et al., J. Immunol., 145: 2677-2685 (1990) und Hart et al., PNAS (USA), 88: 9448-9452 (1991)). Das T1-SP10(A)-Peptid induziert anti-HIV neutralisierende Antikörper in Mäusen, Ziegen und Rhesusaffen (Palker et al., PNAS (USA), 85: 1932-1936 (1988); Palker et al., J. Immunol., 142: 3612-3619 (1989); Hart et al., J. Immunol., 145: 2677-2685 (1990) und Hart et al., PNAS (USA), 88: 9448-9452 (1991)), induziert anti-HIV beschränkte CTL der MHC Klasse I in Mäusen (Hart et al., PNAS (USA), 88: 9448-9452 (1991)) und induziert anti-HIV T-Helferzellenwirkungen in Mäusen, Ziegen, Rhesusaffen und Schimpansen (Palker et al., PNAS (USA), 85: 1932-1936 (1988); Palker et al., J. Immunol., 142: 3612-3619 (1989); Hart et al., J. Immunol., 145: 2677-2685 (1990) und Hart et al., PNAS (USA), 88: 9448-9452 (1991)). In einer kürzlich abgeschlossenen Untersuchung mit Mäusen wurde gefunden, dass während C57BL/6 und Balb/c Mäuse hohe Titer an anti-Peptid Antikörper gegen T1-SP10IIIB-Peptide entwickeln, entwickeln diese Mäusestämme keine neutralisierenden Antikörper gegen die HIVIIIB V3-Windung neutralisierende Determinanten. Im Gegensatz dazu entwickeln C57BL/6 und Balb/c Mäuse reichlich neutralisierende anti-HIV Antikörper, wenn sie mit T1-SP10-Peptiden immunisiert werden, die Sequenzen der HIVMN V3-Windung beinhalten.

Es wurden Immunisierungsversuche mit Schimpansen durchgeführt, um die synthetischen Peptide zu testen. Die nachstehend erörterten Ergebnisse zeigen, dass die Schimpansen beim Holloman AFT, Neu Mexiko, reichlich Antikörper und reichlich T-Helferzellwirkungen gegen T1-SP10IIIB(A)-Peptide erzeugen, aber ähnlich wie die Balb/c Mäuse, keine Antikörper gegen die neutralisierende Antikörperdeterminante auf der HIVIIIB V3-Windung entwickelten.

In Fig. 9 wurden die Schimpansen mit den synthetischen HIV env Peptiden immunisiert und ihre Antikörpertiter in einem ELISA-Versuch geprüft. Die Tiere 884 und 1028 wurden mit dem Peptid T1.SP10IIIB immunisiert, das auch beim ELISA-Versuch verwendet worden war. Das Peptid F-T1-SP10IIIB(A) wurde bei der Immunisierung und den ELISA-Versuchen der Tiere 1045 und 1070 verwendet. Alle Immunisierungen erfolgten in IFA + PBS (1 : 1), außer beim Tier 1028, das nach der dritten Immunisierung IM Abszesse entwickelte und nur eine Immunisierung erhalten hat. Die folgenden Immunisierungen erfolgten mit PBS allein.

Wie ersichtlich, waren T1-SP10-Peptide ausgezeichnete Immunisierungsmittel in den Tieren 884 und 1028, während T1-SP10-Peptide mit der fusogenen (F) Domäne von HIBV gp41, die N-terminal an das T1-SP10-Peptid synthetisiert worden waren, keine so hohen Antipeptidtiter oder von so langer Dauer induzierten wie dies Peptide ohne die F-Domäne taten.

Es bleibt festzuhalten, dass die Tiere 1045 und 1070 im 16. Monat vom Immunogen T1- Versuch auf natives gp120 umgestellt wurden, wobei die Tiere 1045 und 1070 sowohl gegen natives gp120 als auch gegen immunisierende Peptide tolerant waren. Es ist auch wichtig festzuhalten, dass eine Injektion beim Tier 884 in Woche 4 zu einem Titeranstieg gegen T1-SP10- IIIB(A)-Peptid führte, eine Injektion beim Tier 1028 zur gleichen Zeit dies jedoch nicht tat. Das Tier 884 wurde mit WA gespritzt, während die Injektion beim Tier 1028 ohne Adjuvans, sondern nur mit PBS erfolgte.

Das Ansprechen auf die Wucherung peripherer einkerniger Zellen (PBMC) auf immunisierende Peptide wurde ebenfalls untersucht (vergl. Fig. 10). Die Peptide T1-SP10IIIB und T1-SP10IIIB(A) induzieren hohe Spiegel an wuchernden zirkulierenden PBMC in den Tieren 884 und 1028. Diese Spiegel fielen auf nicht mehr nachweisbare Niveaus nach 6 Monaten Pause (14 Monat), stiegen aber in den Tieren 884 und 1028 wieder an. Die Wucherungswirkungen im Tier 1028 stiegen mit jeder Injektion nach 6 Monaten Pause, obwohl die Immunisierungen mit PBS allein ohne Adjuvans erfolgten.

Genau wie bei B-Zellwirkungen wucherten bei den Tieren 1045 und 1070, welche mit F-T1-SP10IIIB(A)-Peptid immunisiert worden waren, gegenüber T1-SP10IIIB(A)-Petpid nicht. Als die letzteren beiden Tiere mit T1-SP10IIIB(A)-Peptid immunisiert wurden, welches ein gutes Immunisierungsmittel in 884 und 1028 war, entwickelte keines der Tiere 1045 und 1070 eine Wucherungswirkung gegen T1-SP10IIIB(A), was beweist, dass die N-terminale Einführung der F-Domäne in das T1-SP10-Peptid eine Toleranz erzeugende Funktion ausübte, die die Tiere 1045 und 1070 gegenüber T1- und SP10-Bereiche von gp 120 verträglich machte. Während die Tiere 884 und 1028, wie in Tabelle XVI gezeigt, beide beim Wucherungsversuch auf das native gp 120 ansprachen, verhielten sich die Tiere 1045 und 1070 sowohl gegen natives gp120 als auch gegen die immunisierenden Peptide tolerant.

Die PBMC Wucherungswirkung bei Schimpansen gegen PHA, die mit synthetischen Peptiden immunisiert wurden, wurde gleichfalls untersucht (vergl. Fig. 11). Die Werte zeigen, dass während die Tiere 1045 und 1070 sich gegenüber den T1- und SP10-Domäne von HIV gp120 tolerant verhielten, die PBMC PHA-Wirkungen in diesen Tieren während der gesamten Immunisierungsdauer normal waren.

Die gleichen T1-SP10IIIB-Peptidchargen, die bei der Untersuchung mit Schimpansen verwendet wurden, wurden auch als Immunisierungsmittel in Ziegen verwendet und es wurden hohe anti-HIV Neutralisationstiter in Ziegen erhalten (vergl. Fig. 12). Folglich sind T1-SP10- Peptide überragende Immunisierungsmittel mit IFA in Schimpansen mit bemerkenswerten anti- Peptid Serum Antikörpertitern von > 1 : 102400 (vergl. Fig. 9) und zur Induzierung von T-Zellwirkungen gegen T1-SP10 und gegen natives HIV gp120 (vergl. Fig. 10 und Tabelle XVI unten).

Tabelle XVI Einführung von Tritium-markiertem Thymidin in periphere einkernige Blutzellen und anschließende in vitro Stimulierung mit HIV env gp120.

* Die Werte geben die während der Immunisierungsdauer beobachteten gp120 Spitzenwirkungen wieder. Die Werte der Tiere 884, 1028 und 1045 geben die Spitzenwirkungen bei Verwendung von 2 ul/ml bis 0,5 u1/ml HIVIIIB(LAI) rekombinantem gp120 wieder. Die Werte für das Tier 1070 geben die Spitzenwirkungen bei Verwendung von 1 ug/ml bis 0,5 ug/ml nativem HIVIIIB-(LAI) gp 120 wieder.

Tabelle XVII Anti-HIVIIIB(LAI) neutralisierende Antikörpertiter in Schimpansen, immunisiert mit synthetischen Peptiden, die T- und B-Zelldeterminanten der HIVIIIB(LAI) pg120 Hülle enthalten.

* Die Werte geben die 90% Neutralisationstiter von HIBIIIB(LAI) wieder (0 bis 64 Infektionseinheiten pro Kalotte bei den reversden Transcriptaseinhibierungsversuchen in vitro.

Die hohen neutralisierenden Antikörperwirkungen bei Ziegen gegenüber der gleichen, bei Schimpansen verwendeten T1-SP10-Peptidcharge zeigte, dass Schimpansen neutralisierende V3-Sequenzen nicht als Immunisierungsmittel erkannten, während andere, nicht-neutralisiernde T1-SP10IIIB-Peptide in Schimpansen neutralisierend wirkten. Es ist demzufolge möglich, dass durch Schimpansen und einkernige Zellen von Mäusen eine selektive Proteolyse der HIVIIIB V3-Windung erfolgt, oder was wahrscheinlicher ist, dass in Schimpansen und Mäusen eine genetische Beschränkung der Antikörperwirkung gegenüber neutralisierenden Determinanten der V3-Windung vorliegt.

In Rhesusaffen führt die Injektion von 500 ug gereinigter T1-SP10MN(A)-Peptide, wie gezeigt, zu sehr hohen Spiegeln neutralisierender anti-HIV Antikörper in 4/4 Tieren (vergl. Fig. 13-15). Zusätzlich lieferte bei einem von vier Affen die Imunmisierung kreuzreaktive neutralisierende anti-HIV Antikörper, welche die HIVIIIB- und HIVMN-Viren neutralisierten (vergl. Tabelle XVIII unten).

Tabelle XVIII Neutralisierende Serum-Antikörpertiter beim, Synzytiumversuch des mit 500 ugT1-SP10MN(A)-Peptid immunisierten Rhesusaffen 10970.

ND = Nicht durchgeführt

* = 68% Synzytiuminhibierung bei 1 : 10 Verdünnung

Sprechen daher 25% Schimpansen und Menschen auf das T1-SP110MN(A)-Peptid an und bilden kreuzreaktive neutralisierende anti-HIV Antikörper, dann könnten weitere 5% von Lebewesen, die von einem nicht-MN-ähnlichen HIV-Isolat befallen werden, von einer HIV- Infektion geschützt werden. Bezüglich weiterer Daten von Affen vergl. die Fig. 16 und 17.

Weil die T1-SP10IIIB(A)-Peptide in den Tieren 884 und 1028 keine anti-HIV neutralisierenden Antikörper induziert haben und weil F-T1-SP10IIIB(A)-Peptide in den Tieren 1045 und 1070 Toleranz erzeugten, wurden alle Schimpansen entweder im 16. Monat (Tiere 884, 1028) oder im 17. Monat (Tiere 1045, 1070) mit dem T1-Sp10MN(A)-Peptid immunisiert. Die Überlegung dabei war, festzustellen, ob A) das T1-DP10MN(A)-Peptid die Toleranz in den Tieren 1945 und 1070 aufheben kann, und ob B) eines der Tiere die V3 neutralisierende Determinante der HIV MN V3-Windung genetisch erkennen könnte, da es schien, dass keines der Tiere die von den T1-SP10IIIB-Peptiden dargebotene V3-Determinante von HIB IIIB erkennen konnte. Fig. 18 zeigt, dass nach der Immunisierung aller 4 Schimpansen mit 0,1 mg/kg T1-SPlOMN(A)-Peptid, drei der 4 Tiere (884, 1028 und 1045) das Auftreten schwacher anti-HIV neutralisierender Antikörper im Serum zeigten (gestrichelte Linie), während das Tier 1070 hohe Spiegel an anti-HIV neutralisierenden Antikörpern entwickelte, die einer Neutralisation von > 80% bei 1 : 20 entsprachen, und auch HIV 11113 über kreuz neutralisierte (Tabelle XIX, durchgezogene Linie, Fig. 18). Diese Aufhebung der Toleranz konnte auch im Titeranstieg des T1-SP10MN(A)-Peptids im Serum der Tiere 884, 1045 und 1070 beobachtet werden (Fig. 19): Das Tier 1028 bekam im Zusammenhang mit den Immunisierungen frühzeitig ein Abszess und erhielt nach einer Versuchsdauer von 4 Monaten keine IFA und wies nach der anfänglichen Immunisierung des Peptids mit IFA nie einen Antikörperanstieg gegenüber dem HIV-Peptid auf.

Tabelle XIX Neutralisation von HIV LAI/IIIB und HIV MN beim Synzytiuminhibierungsversuch in mit T1-SP10 Peptiden immunisierten Schimpansen

- = < 48% Inhibierung von Synzytia

+/- = ≥49% und < 80% Inhibierung von Synzytia

+ = ≥50% Inhibierung von Synzytia, Titer 1 : 10

++ = ≥80% Inhibierung von Synzytia, Titer 1 : 20

Die Beobachtung, dass neutralisierende Antikörper im Schimpansen 1070 sowohl HIV MN- als auch IIIB-Isolate neutralisierten, konnte entweder auf das Vorliegen von typspezifischen Antikörpern, die sowohl von HIVMN- als auch von HIVIIIB-Peptiden induziert wurden (Rusche et al., Proc. Natl. Acad. Sci. (USA), 95: 3198 (1988)) oder auf die Induktion über kreuz neutralisierender anti-GPGRA-Antikörper durch die T1-SP10MN(A)-Peptide zurückgehen. Antikörpertiter gegen ein verstümmeltes SP10IIIB-Peptid, SP10D, IRIQRGPGR, wurden beim ELISA-Versuch mit dem Serum des Schimpansen 10780 verwendet. Die Endpunkts- Titer gegen dieses Peptid betrugen zwischen dem 23.10.90 und 03.12.91 (während 3 Monate der 17 monatigen Untersuchung) 1 : 8900 oder weniger. Im Anschluss an die erste Immunisierung des Tiers 1070 mit T1-SP10MN(A) am 03.12.92 stiegen die Antikörpertiter gegenüber dem SP10D-Peptid von 1 : 800 auf 1 : 3200 am .7.01.92 und auf 1 : 12800 am 04.02.92. Während der gleichen Zeitspanne stiegen die Antikörpertiter von 1070 gegenüber dem T1-SP10MN(A)- Peptid von 1 : 12800 auf 1 : 102000, während die Titer gegen T1-SP10IIIB von 1 : 3200 auf 1 : 25600 stiegen.

Absorptionsuntersuchungen zur Absorption der neutralisierenden Antikörper aus dem Serum von Tier 1070 zeigten, dass die gesamte anti-HIV MN neutralisierende Aktivität mit dem SP10MN(A)-Peptid absorbiert werden konnte und ein Teil der HIV MN neutralisierenden Aktivität mit einem Peptid mit der Sequenz IGPGRAIGPGRAIGPGRAC (DP2) (Jahavarian et al., Science, 250 : 1590 (1990)) heraus absorbiert werden konnte, das nur Sequenzen aus dem Ende der V3-Windung enthält, der sowohl HIV MN als auch HIV IIIB (Fig. 20) gemeinsam sind. Folglich neutralisiert ein Teil der durch T1-SP10MN(A)-Peptide induzierten Antikörperwirkung bei den Schimpansen HIV MN und HIV IIIB über kreuz und sind gegen die konservierten Sequenzen am Ende der HIV gp120 V3-Windung gerichtet.

Wesentlich ist, dass an Rhesusaffen gezeigt wurde, dass die Injektion von 500 ug gereinigten T1-SP10MN(A)-Peptiden in 4/4 Tieren sehr hohe Spiegel anti-HIV neutralisierender Antikörper (Fig. 20-24) und in 1 von 4 Rhesusaffen kreuzreaktive anti-HIV neutralisierende Antikörper lieferte, welche die HIVIIIB- und HIVMN-Viren neutralisierten (Tabelle XVIII und XX).

Tabelle XX Kreuzneutralisation von HIV LAI/IIIB beim RT Inhibierungsversuch mit Seren immuner, mit T1-SP10-Peptiden immunisierter, Rhesusaffen.

Die Fig. 25 zeigt, dass das DP2 (IGPGRAIGPGRAIGPF-RAC)-Peptid im Serum des Rhesusaffen 18987 die anti-HIVIIIB neutralisiernde Aktivität absorbiert. Tabelle XXI zeigt die bei den Untersuchungen an Schimpansen und Rhesusaffen verwendeten Peptidsequenzen.

Tabelle XXI Varianten der von HIV MN und IIIB abgeleiteten T1-SP10-Peptide

Beispiel 10

Das Folgende ist eine Anweisung zur Immunisierung menschlicher Patienten. HIV serumnegative Personen werden mit einem polyvalenten Gemisch von T1-SP10(A)-Peptiden (vergl. Tabelle XXII und XXIII) immunisiert, die darauf ausgelegt sind, neutralisierende Antikörper gegen etwa 80% der gegenwärtigen HIV-Isolate in den Vereinigten Staaten zu erzeugen.

Tabelle XXII Sequenzen verstümmelter T1-SP10(A)-Peptide für die Immunisierung beim Menschen
Tabelle XXIII Sequenzen des T1-SP10A-Peptids in voller Länge für die Immunisierung beim Menschen

Experimentalanweisung

Menschliche Patienten, beide HLA 2A+ und HLA 2A-, werden über bis zu zwei Jahre untersucht. Während der Behandlung wird sowohl die Bildung neutralisierender Antikörper gegen HIVMN- und andere HIV-Isolate als auch die Bildung von T-Helferzellen und/oder beschränkt anti-HIV CTL der Klasse I gemessen.

Die zu verwendenden Immunisierungsmittel werden T1-SP10(A)-Peptide sein, von denen erwartet wird, dass sie Antikörper gegen 80% der HIV-Isolate der Los Alamos Datenbank erzeugen (Myers et al., Human Retroviruses and AIDS 1991). Manche Patienten werden die Immunisierungsmittel von Tabelle XX und manche die Immunisierungsmittel von Tabelle XIX erhalten.

Jeder Patient wird als Immunisierungsmitteldosis etwa 0,05 mg/kg/Peptid oder jeder 1 mg Peptid erhalten. Erfolgt kein Ansprechen auf den ursprüngliche Dosierungsplan, wird die Dosis verdoppelt und das Dosierungsschema nach drei Monaten wiederholt.

Unvollständiges Freunds Adjuvans (IFA) wird mit dem Immunisierungsmittel zum 1 : 1 Vol./Vol. Gemisch vereinigt (Hart et al., J. Immunol., 145: 2677-2685 (1990)). Das Gesamtvolumen sollte bei jeder Immunisierung 2 ml betragen.

Die Immunisierungsmittel werden IM verabreicht. Das Immunisierungsmittel wird auf ein Gesamtvolumen von 2 ml gemischt und IM verabreicht, jeweils 1 ml auf einer von zwei Seiten (rechter oder linker Oberarm, rechte oder linke Hütte).

Die Immunisierung erfolgt nach dem 0. Monat, 1. Monat und 3. Monat. Die Patienten werden 4 Wochen nach jeder Immunisierung untersucht. Nach der 3. Immunisierung werden die gegen HIV wirksamen Titer geprüft und über den Beginn der Immunisierung mit einer höheren Dosis nach einer Pause von 3 Monaten entschieden.

An den Patienten werden Blut- und Urin-Routineuntersuchungen durchgeführt. Die folgenden Blutproben werden benötigt:

Serum (10 ml) (ungefähr 20 ml Blut) wird verwendet, um die Bindung des T1-SP10- und SP10-Peptids in RIA und die HIV gp120-Bindung im RIP/Western Tüpfelversuch zu untersuchen. Das Serum wird auch dazu verwendet, die Neutralisationstiter von HTLV-MN- und Feld-HIV-Isolaten mittels reversem Transcriptase- und/oder Synzytiumversuch zu bestimmen. Serumroutinechemie bezüglich Toxizität (Leberfunktionstest, Nierenfunktion und chem 18 Panel) und eine vollständige Blutauszählung (10 ml heparinisiertes Blut) erfolgen.

Periphere Blutzellen (60 ml Blut) werden dazu verwendet, um das Ansprechen der T- Zellwucherungen auf PHA, die TT Kandidaten T-SP10- und SP10-Peptid, gp120 und OKT3 (etwa 30 ml heparinisiertes Blut) zu untersuchen. Die T-Zell-, B-Zell-, NK-Zell-, CD4- und CD8-Zellzahlen werden ebenfalls gemessen (etwa 5 ml heparinisiertes Blut). Schließlich werden CTL Versuche an autologen oder HLA-identischen EBV-transformierten B-Zelllinien unter Verwendung von mit Kuhpocken infizierten gp160 Zielzellen und mit Peptid beschichteten Zielzellen durchgeführt.

Beispiel 11

Es wurde ein Konzept zur Auslegung eines experimentellen, synthetischen Immunisierungsmittels auf Peptidbasis zur Induzierung von T-Helferzellen (Th), neutralisierenden Antikörpern und beschränkt zytotoxischen T-Lymphozyten der MHC Klasse I (CTL) gegen HIV native Proteine oder HIV-Proteine auspressende Zielzellen entwickelt (Palker et al., Proc. Natl. Acad. Sci. (USA), 85: 1932 (1988); Palker et al., J. Immunol., 142: 3612 (1989); Hart et al., J. Immunol., 145: 2677 (1990); Hart et al., Proc. Natl. Acad. Sci. (USA), 88: 9448 (1991); Haynes et al., AIDS Res. & Human Retroviruses, 6: 38 (1990); Haynes et al., J, Immunol., 151: 16646 (1993); Haynes et al., J. Exp. Med., 177: 717 (1993); Haynes et aL, Trans. Amer. Assoc. Physician, 106: 3 (1993); Yasutomi et al., J. Immunol., 151: 5096 (1993)). (Ein allgemeines Schema für einen auf HLA basierenden Impfstoff für AIDS ist in Fig. 30 dargestellt. Th1...n-B1...n schließt die Konstruktion Th-gp10 ein, und zum Beispiel, C4-V3. Th 1...n- Tc 1...n ist mit Th-CTL (CTL = X) gleichwertig.

Ein allgemeines Konzept für ein Immunisierungsmittel zur Induzierung neutralisierender Antikörper erfordert die Synthese eines oder mehrerer Th-Epitope von HIV-Proteinen, die N-tenninal zur neutralisierenden Domäne der V3-Windung der gp120 Hülle sind (Th-B, Fig. 26). Für die Induktion anti-HIV oder anti-SIV beschränkter CTL der MHC Klasse I erwiesen sich sowohl Th-B-CTL als auch Th-CTL-Peptidkonzepte als erfolgreich (Fig. 26). (Hart et al., Proc. Natl. Acad. Sci. (USA), 88: 9448 (1991); Yasutomii et al., J. Immunol., 151: 5096 (1993)). Prototypen von Immunisierungsmitteln auf der Basis synthetischer Peptide, welche Th-B-CTL-Epitope von HIVIHB, MN oder RF env dp120 umfassen, induzieren a) Th-Wirkungen gegen natives gp120 in Mäusen, Ziegen, Rhesusaffen und Schimpansen (Palker et al., Proc. Natl. Acad. Sci. (USA), 85: 1932 (1988); Palker et al., J. Immunol., 142: 3612 (1989); Hart et al., J, Immunol., 145: 2677 (1090); Haynes et al., J. Exp. Med., 177: 717 (1993)) und induzieren b) in Ziegen, Rhesusaffen und Schimpansen B-Zellen neutralisierende Antikörperwirkungen, die in spezifischer Weise HIV-Isolate aus dem Labor neutralisierten (Palker et ai, Proc. Natl. Acad. Sci. (USA), 85: 1932 (1988); Palker et al., J, Immunol., 142: 3612 (1989); Hart et al., J. Immunol., 145: 2677 (1990); Haynes et al., J. Immunol. 151: 1646 (1993); Haynes et al., J. Exp. Med., 177: 717 (1993); Haynes et al., Trans. Amer. Assoc. Physician, 106: 31 (1993)) und induzierten c) in Mäusen und Rhesusaffen anti-HIV oder SIV beschränkte CTL der MHC Klasse I, welche HIV- oder SIV-Proteine auspressende Zielzellen abtöten (Hart et al., Proc. Natl. Acad. Sci. (USA), 88: 9448 (1991); Yasutomi et al., J. Immunol., 151: 5096 (1993)). An Rhesusaffen wurde demonstriert, dass das T1-SP10MN(A)-Peptid in ausgewählten Tieren Antikörper induziert, die in erster Line mit der IGPGRAF-Sequenz des Endes der V3 Windung reagierten und sowohl HIVIIIB, HIVMN, HIVRF als auch in CEM-Zellen gewachsene HIV-Primärisolate über kreuz neutralisierten (Haynes et al., J, Immunol., 151: 1646 (1993)).

Konzept des Prototyps eines polyvalenten HIV Immunisierungsmittels.

Wegen der außerordentlichen Unterschiedlichkeit, die bei HIV-Isolaten sowohl hinsichtlich der geographischen Lage als auch hinsichtlich der Patienten besteht, wird wahrscheinlich das Konzept eines für HIV-Isolate maßgeschneiderten Mehrzweck-HIV-Immunisierungsmittels für bestimmte geographische Lagen für ein vorbeugendes und therapeutische HIV Immunisierungsmittel erforderlich sein. (Palker et al., J. Immunol., 142: 3612 (1989); Haynes et al., Trans Amer. Assoc. Physician, 106: 31 (1993)). Zu diesem Zweck wurde der Prototyp eines polyvalenten HIV Immunisierungsmittels konzipiert, das Th-B-CTL-Epitope enthält, welche 4 der gängigsten Motive von HIV-Isolaten in Clave E, HIVMN, HIVRF, HIVEV91 und HIVCANO wiederspiegeln (Fig. 26 und 27). Jedes dieser Prototyppeptide beinhaltet mindestens zwei Th-Determinanten, zwei beschränkte CTL Determinanten der Klasse I, eine durch HLA A2 und A3 beschränkte (Clerici et al., Nature, 339: 383 (1989)) und ein anderer B7 beschränkter (Safrit et al., Characterization of HKLA-B7-restricted cytotoxic T lymphocyte clones specific for the third variable region HIV gp120, isolated from two patients during acute seronversion. Presented at the 6th NCVDG meeting 30.10.-04.11.1993), und drei oder mehr von anti-HIV neutralisierenden Antikörpern erkannte Epitope (Paiker et al., Proc. Anti. Acad. Sci. (USA), 85: 1932 (1988); Rusche et al., Proc. Natl. Acad. Sci. (USA), 85: 3188 (1988); Jahavarianet al., Science, 250: 1590 (1990)) (Fig. 26 und 27). Vorklinische Untersuchungen haben gezeigt, dass zwei der Komponenten [T1-SP10RF(A) u. T1-Sp10EV91(A)] typspezifische anti-V3-Peptidwirkungen [anti-SP10(A)] (Tabelle XXIV) induzierten, während zwei Komponenten [T1-SP10MN(A) und T1-SP100CANO (A)] in der Breite eine kreuzreaktive anti-V3-Peptid Antikörperwirkung induzierten (Tabelle XXIV).

Tabelle XXIV Fähigkeit synthetischer HIV Hüllenpeptiden zur Induzierung von anti-Peptid Antikörpern nach drei Immunisierungen

Balb/c Mäuse wurden dreimal mit 50 ug monovalenten Peptiden in IFA (Seppic ISA 51) subcutan immunisiert. Den Tieren wurde 2 Wochen nach der Immunisierung Blut angenommen und Antikörpertiter unter Verwendung eines ELISA-Endpunktsversuchs (E/C = 3,0) bestimmt. Die Werte stellen das geometrische Mittel der Titer der Serum-Antikörper von drei Mäusen pro Punkt dar.

Fähigkeit von HIV env Peptiden zur Induzierung kreuzreaktiver Peptidwirkungen gegen afrikanische (Clave A) und thailändische (Clave E) V3-Windungspeptide von HIV-Isolaten.

Zusätzlich wurden Seren von Ziegen und Mäusen mit Gemischen aller 4 Peptide (Tabelle XXV) immunisiert, die Antikörper enthielten, welche ebenfalls mit dem T1-SP10 (A) A.con-Peptid (ein Th-B-CTL-Peptid, das die übereinstimmende V3-Windungssequenz von Clave A in Afrika wiederspiegelt) und in einem geringer Maße mit dem T1-SP10(A). E con-. Peptid (ein Th-B-CTL-Peptid, das die übereinstimmende V3-Windungssequenz in Thailand widerspiegelt) (Tabelle XXV). Wurden Seren von Mäusen, die nur mit jeweils einer der 4 Komponenten des poyvalenten Gemischs immunisiert waren, auf ihre Fähigkeit zur Bindung an das afrikanische T1-SP10(A) A.con.-Peptid geprüft, wurde gefunden, dass das T1-Sp10 CANO(A)-Peptid für die Erzeugung aller kreuzreaktiven Antikörper gegen die übereinstimmende afrikanische Clave A Sequenz verantwortlich war. Folglich scheinen, obwohl die primären V3-Sequenzen (Fig. 27) verschieden sind, sekundäre Strukturen und möglicherweise Strukturen höherer Ordnung der V3-Windung des HIVCANO-Isolats die Fähigkeit zu besitzen, kreuzreaktive anti-V3-Antikörper gegen viele unterschiedliche HIV V3-Motive zu induzieren.

Tabelle XXV Fähigkeit von polyvalenten Th-B HIV env Peptidgemischen zur Erzeugung und Erhöhung von Serumantikörpern in Mäusen und Ziegen, welche mit dem Th-B Peptid mit V3 Clave A (VHIGPGQAFTYAT) übereinstimmenden Sequenzen über kreuz reagieren.

Die Werte stellen das geometrische Mittel der Titers von je 3 Mäusen und 2 Ziegen dar, die mit dem polyvalenten Peptidgemisch Th-B-HIV env gespritzt wurden.

Die verwendeten Verfahren sind in Haynes et al., J. Immunol., 151: 1646 (1993); Haynes et al., J. Exp. Med., 177: 717 (1993); Haynes et al., Trans. Amer. Assoc. Physician, 106: 31(1993), beschrieben.

T1-SP10(A)-Sequenzen afrikanischer (A. Con.) und südostasiatischer (E. Con.) HIV-Isolate

Human Retroviruses and AIDS 1993, herausgegeben von G. Myers, J. A. Berzofsky, B. Korber, R: F: Smith und G. N. Pavlakis, verlegt von der Theoretical Biology and Biophysics Group T-10, Postfach K710, Los Alamos National Laboratory, Los Alamos, NM 87545.

Neutralisierende Antikörperwirkungen, erzeugt durch das polyvalente HIV env Immunisierungsmittel.

Was die Neutralisierende Antikörperwirkung betrifft, binden sich Seren von Tieren, die mit dem polyvalenten Immunisierungsmittel (Fig. 27) immunisiert wurden, sowohl beim Radioimmunoprecipitationsversuch als auch beim ELISA-Versuch an HIV gp120IIIB und an gp120SF2. Seren dieser Tiere haben beim Synzytiuminhibierungsversuch HIVMN- und RF- Isolate neutralisiert.

Nachweis neutralisierender CD4-V3 Konformationsdeterminanten in HIV gp120.

Die menschlichen 17b und 48d anti-gp120 mabs wurden aus menschlichen PBMC B- Zellen von HIV-infizierten Patienten isoliert (Thali et al., J. Virol., 67: 3978-3988 (1993)). Die 17b und 48d mabs blockieren über kreuz Maus mabs, welche die CD4-Bindung an gp120 blockieren, neutralisieren in der Breite ungleichartige HIV-Isolate, blockieren aber nicht in sich oder von sich aus die gp120-CD4-Bindung (Moore et al. Privatmitteilung, 1994; Thali et al., J. Virol., 67: 3978 (1993)). Vielmehr wird die Bindung der 48d mabs an das native gp120 angepasst und anschließend CD4 an gp120 gebunden. Es wurde gefunden, dass ein Peptid, T1- SP10CANO(A), sich an mab 48d bindet (Fig. 28), und die optimale Bindung von mab 48d an das HIV env Hybridpeptid T1-SP10CANO(A) von der Anwesenheit des CD4-Peptids T1N- terminal zum SP10CANO(A) Peptid abhing (Fig. 29). Folglich spiegelt das T1-SP10CANO (A) C4-V3-Hybridpeptid eine Konformationsdeterminante von HIV gp120 wieder, die von einem in der Breite wirksamen, neutralisierenden menschlichen mab erkannt wird. Es ist von Interesse, dass Wyatt et al., J. Virol., 66: 6997 (1992) und Moore et al., J. Virol., 67: 47885 (1993)) vermutet haben, dass die V3-Windung [SP10(A)] und der C4, T1-Bereich im nativen gp120 physikalisch nahe beieinander liegen. Folglich zeigen die derzeitigen Werte direkt dass das T1-SP10CANO(A)-Peptid in der Breite C3-V3-Konformationsdeterminanten von nativem gp129 nachahmen kann.

Allgemeines Konzept zur Identifizierung multipler CD4-V3 [T1-SP10(A)]-Peptide, die C4-V3-Konformationsdeterminanten anderer HIV-Isolate wiedespiegeln.

Während die HIV V3-Windung selbst vorzugsweise typspezifische anti-HIV neutralisierende Antikörper induziert, wird die durch T1-SP10CANO(A) definierte C4-V3-Determinante etwas breiter kreuzreaktive neutralisierende Antikörper induzieren. Dies ist von der Tatsache her bekannt, dass der von seropositiven Patienten abgeleitet, menschliche, monoklonale Antikörper 48d sich an eine komplexe Konformationsdeterminante auf der Oberfläche von gp120 bindet, sich an ein breites Spektrum von HIV-Isolaten bindet und ungleiche HIV-Isolate neutralisiert, wie HIVIIIB und HIVMN (Thali et al., J. Vieol., 67: 3978 (1993); Moore, J. Privatmitteilung, 1994). Demzufolge würde ein allgemeines Konzept zur Identifizierung multipler C4-V3-Peptide darin bestehen, eine große Zahl von C4-Sequenzen abgeleitete C4-V3- Peptiden zu konstruieren (zum Beispiel von Aminosäuren 419 bis 428 aus dem HIVMN-Isolat und von homologen Bereichen in anderen HIV-Isolaten), die N-terminal an SP10 oder SP10 (A)-Bereiche gebunden sind (wie die Aminosäuren 301-327 von HIVMN und von homologen Bereichen in anderen HIV-Isolaten) und aus Sequenzen, die in der Los Alamos Datenbank aufgeführt sind (Human Retroviruses and AIDS, 1991, 1992, 1993, herausgegeben von G. Myers, J. A. Berzofsky, B. Korber, B. F. Smith und G. N. Pavlakis; verlegt von der Theoretical Biology and Biophysics Group T-10, Postfach K710, Los Alamos National Laboratory, Los Alamos, NM 87545) (vergl. Tabelle XXVI oder andere Beispiele).

Man würde anschließend ungefähr 40 bis 100 dieser unterschiedlichen C4-V3-Peptide gegen ein Kombinationsschema mit lang- und kurzkettigen Imminoglobulin variablen Genen serientesten, die auf der Oberfläche von Phagozyten ausgepresst sind (Borbas et al. Proc. Natl. Acad. Sci. (USA), 88: 7978 (1991)). Die Arbeit von Borbas et al. stellt ein Verfahren zum Serientesten einer großen Zahl (10&sup7; bis 10&sup8;) monoklonaler menschlicher Antikörper bereit, die von einem Patienten mit HIV-Infektion abgeleitet wurden und die es ermöglichen, bei der Suche nach Antikörperspezies gegen komplexe Konformationsdeterminanten auf gp120, ein breites Spektrum von Antikörperwirkungen durchzuforsten. Bei Verwendung dieser Technologie können C4-V3-Antikörper identifiziert werden, die eine solche Konformation aufweisen, dass sie in die Fab-Kerbe des variablen Bereichs der lang- und kurzkettigen Heterodimeren passen, die im Kobinationsschema auf der Oberfläche von Phagozyten ausgepresst sind. Diese Fab Monoklonalen können isoliert und geklont werden (Borbas et al., Proc. Natl. Acad. Sci. (USA), 88: 77978 (1991)). Am wichtigsten ist, dass C4-V3-Peptidkonzepte, welche native gp120 C&sub4;-V3-Konformationsdeterminanten einer breiten Vielfalt von HIV-Stämmen wiederspiegeln, identifiziert werden können. Erfolgt diese Art von Protein-basiernder Auswahl anhand der Komnbinationsschemata, die sich von einer großen Zahl HiV-infizierter Personen aus vielen unterschiedlichen geographischen Stellen mit HIV-Infektion auf der ganzen Welt ableiten, kann ein breite Auswahl von C4-V3-Peptiden, welche in der Breite reaktive neutralisierende Determinanten des V3-V3-Bereichs des nativen gp120 nachahmen identifiziert werden können, und zum Beispiel zusammen mit dem T1-SP10CANO(A) des C4-V3-Peptidprototyps zu einem multivalenten C4-V3-Immunisierungsmittel auf Peptidbasis zur Induktion von hochgradig kreuzreaktiven, mit neutralisierenden Antikörpern gegen C4-V3-Konformationsdeterminanten einer Vielzahl von HIV-Stämmen kombiniert werden.

Tabelle XXVI C4-V3 Immunisierungsmittelkonstruktionen

Sequenzen entnommen aus Sequenzen der Los Alamos Datenbank, Human Retroviruses and AIDS 1991, herausgegeben von G. Myers, J. A. Berzofsky, B. Korber, R: F: Smith und G. N. Pavlakis, verlegt von der Theoretical Biology and Biophysics Group T-10, Postfach K710, Los Alamos National Laboratory, Los Alamos, NM 87545.


Anspruch[de]

1. Peptid der allgemeinen Formel:

F-Th-SP10 (X)

Th-SP10 (X)

Th-SP10

oder

F(X)

worin:

F für eine Aminosäuresequenz steht, ableitbar von der mutmaßlich fusogenen Domäne von HIV env gp41 oder einer funktional dazu äquivalenten Sequenz;

TH für eine Aminosäuresequenz steht, umfassend ein T Helferepitop;

SP10 für ein hydrophiles Peptid steht, umfassend eine Aminosäuresequenz von bis zu etwa 35 Einheiten Länge und entsprechend mindestens einer antigenen Determinante des Hüllen-Glycoproteins von HIV, das von B Lymphozyten erkannt wird, wobei das Peptid in der Lage ist, wenn es kovalent an ein Trägermolekül gebunden ist, in einem Säuger die Erzeugung von hohen Titern von schützenden, typspezifischen Antikörpern gegen HIV zu induzieren; und

(X) für eine Aminosäuresequenz steht, entsprechend einer HIV-Proteinsequenz, erkannt von beschränkt zytotoxischen T-Zellen der MHC Klasse I oder Klasse II.

2. Peptid gemäß Anspruch 1, worin das Peptid der Formel F-TH-SP10 (X) entspricht.

3. Peptid gemäß Anspruch 1, worin das Peptid der Formel TH-SP10 (X) entspricht.

4. Peptid gemäß Anspruch 1, worin das Peptid der Formel TH-SP10 entspricht.

5. Peptid gemäß Anspruch 1, worin das Peptid der Formel F(X) entspricht.

6. Peptid nach einem der Ansprüche 1 bis 5 zur Verwendung in einem Verfahren zur Impfung gegen AIDS.

7. Verwendung des Peptids nach einem der Ansprüche 1 bis 5 zur Herstellung eines Medikaments zur Impfung gegen AIDS.

8. Mimetop einer Konformationsdeterminante des nativen HIV gp120 C4-V3-Bereichs zur Verwendung zum Induzieren von Antikörpern in einem Primaten, die den menschlichen Immunschwächevirus (HIV) neutralisieren.

9. Mimetop gemäß Anspruch 8, das darstellt:

KQIINMWQEVGKAMYACTRPHNNTRKSIHMGPGKAFYTTG

(T1-SP10CANO (A)).

10. Verwendung eines Mimetops einer Konformationsdeterminante des nativen HIV gp120 C4-V3-Bereichs für die Herstellung eines Medikaments zum Induzieren von Antikörpern in einem Primaten, die den menschlichen Immunschwächevirus (HIV) neutralisieren.

11. Verfahren zum Serientesten von Peptiden gemäß einem der Ansprüche 1 bis 5 auf die Fähigkeit, neutralisierende Antikörper gegen mehr als ein HIV-Isolat zu bilden, umfassend:

i) Kontaktbringen von einem der Peptide in vitro mit einem monoklonalen Antikörper, der eine Konformationsdeterminante des nativen HIV gp120 C4-V3-Bereichs erkennt, unter solchen Bedingungen, das eine Bindung auftreten kann, und

ii) Ermitteln, ob das Peptid an den monoklonalen Antikörper bindet.







IPC
A Täglicher Lebensbedarf
B Arbeitsverfahren; Transportieren
C Chemie; Hüttenwesen
D Textilien; Papier
E Bauwesen; Erdbohren; Bergbau
F Maschinenbau; Beleuchtung; Heizung; Waffen; Sprengen
G Physik
H Elektrotechnik

Anmelder
Datum

Patentrecherche

Patent Zeichnungen (PDF)

Copyright © 2008 Patent-De Alle Rechte vorbehalten. eMail: info@patent-de.com