PatentDe  


Dokumentenidentifikation DE69831412T2 18.05.2006
EP-Veröffentlichungsnummer 0000996731
Titel MULTIPLE SKLEROSE UND/ODER RHEUMATISCHE POLYARTHRITIS ASSOZIIERTE RETROVIRALE NUCLEINSÄUREN UND ENTSPRECHENDE NUCLEOTIDFRAGMENTE FÜR DIE DIAGNOSTIK, PROPHYLAXE UND THERAPIE
Anmelder Bio Merieux, Marcy l'Etoile, FR
Erfinder PARAHNOS-BACCALA, Glaucia, F-69003 Lyon, FR;
KOMURIAN-PRADEL, Florence, F-69250 Poleymieux au Mont d'Or, FR;
BEDIN, Frederic, F-69002 Lyon, FR;
SODOYER, Mireille, F-69110 Sainte Foy les Lyon, FR;
OTT, Catherine, F-69007 Lyon, FR;
MALLET, François, F-69100 Villeurbanne, FR;
PERRON, Herve, F-69005 Lyon, FR;
MANDRAND, Bernard, F-69100 Villeurbanne, FR
Vertreter BEETZ & PARTNER Patentanwälte, 80538 München
DE-Aktenzeichen 69831412
Vertragsstaaten AT, BE, CH, CY, DE, DK, ES, FI, FR, GB, GR, IE, IT, LI, LU, MC, NL, PT, SE
Sprache des Dokument FR
EP-Anmeldetag 07.07.1998
EP-Aktenzeichen 989364674
WO-Anmeldetag 07.07.1998
PCT-Aktenzeichen PCT/FR98/01460
WO-Veröffentlichungsnummer 0099002666
WO-Veröffentlichungsdatum 21.01.1999
EP-Offenlegungsdatum 03.05.2000
EP date of grant 31.08.2005
Veröffentlichungstag im Patentblatt 18.05.2006
IPC-Hauptklasse C12N 15/48(2006.01)A, F, I, 20051017, B, H, EP
IPC-Nebenklasse C12Q 1/70(2006.01)A, L, I, 20051017, B, H, EP   C07K 14/15(2006.01)A, L, I, 20051017, B, H, EP   A61K 31/70(2006.01)A, L, I, 20051017, B, H, EP   

Beschreibung[de]

Bei der multiplen Sklerose (MS) handelt es sich um eine demyelinisierende Krankheit des Zentralnervensystems (ZNS), deren vollständige Ursache noch immer unbekannt ist.

In zahlreichen Arbeiten wurde die Hypothese einer viralen Ätiologie der Krankheit vorgebracht, es hat sich aber keines der bekannten Viren, die geprüft wurden, als das gesuchte verursachende Agens erwiesen: eine Übersicht über die Viren, die im Lauf der Jahre bei MS untersucht wurden, wurde von E. Norrby und R. T. Johnson erstellt.

In jüngster Zeit wurde bei MS-Patienten ein Retrovirus, das sich von den bekannten menschlichen Retroviren unterscheidet, isoliert. Die Autoren konnten auch zeigen, daß dieses Retrovirus invitro übertragen werden konnte, daß MS-Patienten Antikörper produzierten, die Proteine, die mit der Infektion von leptomeningealen Zellen mit diesem Retrovirus assoziiert sind, erkennen können, und daß die Expression dieses Retrovirus massiv durch die unmittelbar-frühen Gene von gewissen Herpesviren stimuliert werden kann.

Alle diese Ergebnisse sprechen dafür, daß mindestens ein unbekanntes Retrovirus oder ein Virus mit einer nach dem von H. Perron publizierten Verfahren nachweisbaren reverse Transkriptase (RT)-Aktivität, die mit der Bezeichnung "Typ LM7-RT-Aktivität" bezeichnet wird, bei MS ein Rolle spielen.

Die Arbeiten der Anmelderin haben es ermöglicht, mit einem Kulturverfahren wie in dem Dokument WO-A-93 20188 beschrieben zwei kontinuierliche Zellinien, die mit natürlichen Isolaten von zwei verschiedenen MS-Patienten infiziert waren, zu erhalten. Diese zwei Linien, die von menschlichen Plexus-choroideus-Zellen stammten und LM7PC und PLI-2 genannt wurden, wurden am 22. Juli 1992 bzw. am 8. Januar 1993 unter den Nummern 92 072201 und 93 010817 in Übereinstimmung mit den Bestimmungen des Budapester Vertrags bei E.C.A.C.C. hinterlegt. Weiterhin wurden auch die Virusisolate mit LM7-Typ-RT-Aktivität bei E.C.A.C.C. unter der allgemeinen Bezeichnung "Stämme" hinterlegt. Der "Stamm" bzw. das Isolat, das von der Linie PLI-2 geborgen wird und die Bezeichnung POL-2 trägt, wurde bei E.C.A.C.C. am 22. Juli 1992 unter der Nr. V92072202 hinterlegt. Der "Stamm" bzw. das Isolat, das von der Linie LM7PC geborgen wird und die Bezeichnung MS7PG trägt, wurde bei E.C.A.C.C. am 8. Januar 1993 unter der Nr. V93010816 hinterlegt.

Ausgehend von den oben genannten Kulturen und Isolaten, die aufgrund von biologischen und morphologischen Kriterien charakterisiert wurden, hat man sich anschließend bemüht, das mit den in diesen Kulturen produzierten Viruspartikeln assoziierte Nukleinsäurematerial zu charakterisieren.

Die bereits charakterisierten Teile des Genoms wurden für die Durchführung von molekularen Nachweistests des Virusgenoms und von immunserologischen Tests verwendet, wobei die von den Nukleotidsequenzen des Virusgenoms codierten Aminosäuresequenzen dazu verwendet wurden, um die gegen die mit der Infektion eingehenden Epitope und/oder die Virusexpression gerichtete Immunreaktion nachzuweisen.

Mit diesen Mitteln konnte bereits ein Zusammenhang zwischen MS und der Expression von in den anderswo zitierten Patenten identifizierten Sequenzen bestätigt werden. Das von der Anmelderin entdeckte Virussystem weist jedoch Ähnlichkeit mit einem komplexen Retrovirussystem auf. Die gefundenen Sequenzen, die in den von den verschiedenen Zellkulturen von MS-Patienten produzierten extrazellulären Viruspartikeln verkapselt sind, zeigen deutlich, daß eine gemeinsame Verkapselung von Retrovirusgenomen, die verwandt sind, sich jedoch von dem "wilden" Retrovirusgenom, das die infizierenden Viruspartikel produziert, unterscheiden, stattfindet. Dieses Phänomen wurde bei replizierenden Retroviren und bei endogenen Retroviren, die zu der gleichen Familie gehören, ja so sogar heterolog sind, beobachtet. Der Begriff des endogenen Retrovirus ist im Zusammenhang mit unserer Entdeckung sehr wichtig, da man bei MSRV-1 beobachtet hat, daß endogene Retrovirussequenzen, die Sequenzen umfassen, welche zu dem MSRV-1-Genom homolog sind, in normaler menschlicher DNA existieren. Die Existenz von endogenen Retroviruselementen (ERV), die in bezug auf die Gesamtheit oder einen Teil ihres Genoms eine Ähnlichkeit mit MSRV-1 aufweisen, erklärt die Tatsache, daß die Expression des Retrovirus MSRV-1 in den menschlichen Zellen mit nahe verwandten endogenen Sequenzen eine Wechselwirkung eingehen könnten. Diese Wechselwirkungen findet man auch bei pathogenen und/oder infektiösen endogenen Retroviren (z.B. bei gewissen ökotropen Stämmen des Maus-Leukämievirus), bei exogenen Retroviren, deren Nukleotidsequenz teilweise oder ganz in Form von ERVs im Genom des Wirtstiers wiedergefunden werden kann (z.B. exogenes Virus des Mamma-Karzinoms der Maus, das durch die Milch übertragen wird) wieder. Diese Wechselwirkungen bestehen hauptsächlich aus (i) einer Transaktivierung oder Coaktivierung der ERVs durch das replizierende Retrovirus, (ii) einer "illegitimen" Verkapselung von RNA mit Ähnlichkeit zu ERVs, oder ERVs – nämlich Zell-RNA – die einfach kompatible Verkapselungsequenzen aufweisen, in Retroviruspartikeln, die durch die Expression des replizierenden Stamms erzeugt wurden, die manchmal übertragbar sind und manchmal eine wirkliche Pathogenität aufweisen, sowie (iii) mehr oder weniger stark ausgeprägte Rekombinationen zwischen den gemeinsam verkapselten Genomen, insbesondere während den Phasen der reversen Transkription, die zur Bildung von Hybridgenomen führen und die manchmal übertragbar sind und manchmal eine wirkliche Pathogenität aufweisen.

So (i) wurden unterschiedliche Sequenzen mit Ähnlichkeit zu MSRV-1 in den gereinigten Viruspartikeln wiedergefunden; (ii) muß die molekulare Analyse der unterschiedlichen Regionen des Genoms des Retrovirus MSRV-1 unter systematischer Analyse der mitverkapselten, störenden und/oder rekombinierten Sequenzen, die durch die Infektion und/oder Expression von MSRV-1 erzeugt wurden, durchgeführt werden; weiterhin können gewisse Klone defiziente Sequenzabschnitte aufweisen, die durch die Replikation des Retrovirus sowie die Matrizen- und/oder Transkriptionsfehler der reversen Transkriptase erzeugt wurden; (iii) die Sequenzfamilien mit Ähnlichkeit zu einer gleichen Genomregion des Retrovirus sind die Grundlagen eines diagnostischen Pauschalnachweises, der dadurch optimiert werden kann, daß man gleichbleibende Regionen zwischen den exprimierten Klonen identifiziert und Leseraster, die für die Produktion von Antigen-Polypeptiden und/oder Pathogenen, die nur von einem Teil, ja sogar einem einzigen, der exprimierten Klone unter diesen Bedingungen produziert werden können, verantwortlich sind, identifiziert, mit Hilfe der systematischen Analyse von Klonen, die in einer Region eines gegebenen Gens exprimiert werden, kann man die Variationshäufigkeit und/oder die Rekombinationshäufigkeit des MSRV-1-Genoms in dieser Region auswerten und die optimalen Sequenzen für die Anwendungen, insbesondere diagnostische Anwendungen, definieren; (iv) die von einem Retrovirus wie MSRV-1 hervorgerufene Pathologie kann eine direkte Auswirkung von seiner Expression und der Proteine oder Peptide, die dadurch produziert wurden, jedoch auch eine Auswirkung der Aktivierung, der Verkapselung, der Rekombination von ähnlichen oder heterologen Genomen und von Proteinen oder Peptiden, die dadurch produziert wurden, sein; so stellen diese mit der Expression von bzw. Infektion mit MSRV-1 assoziierten Genome einen integrierenden Teil der möglichen Pathogenität dieses Virus dar und sind daher Grundlagen für den diagnostischen Nachweis und bestimmte therapeutische Angriffspunkte. Ebenso kann jegliches Agens das diese Wechselwirkungen, die für die entsprechende Pathogenie verantwortlich sind, assoziiert oder ein Cofaktor dafür ist, wie MSRV-2 oder der unter der Nr. FR-2 716 198 veröffentlichten Patentanmeldung beschriebene gliotoxische Faktor, an der Ausarbeitung einer hochwirksamen diagnostischen Pauschalstrategie, einer prognostischen Pauschalstrategie, einer der Behandlung folgenden und/oder in einer Therapie integrierten Pauschalstrategie, insbesondere von MS, jedoch auch von jeder anderen Krankheit, die mit den gleichen Agentien einhergeht, teilnehmen.

In diesem Zusammenhang hat man eine parallele Entdeckung bei einer anderen Autoimmunkrankheit, nämlich der rheumatoiden Polyarthritis (PR), gemacht, die in der unter der Nr. 95 02960 eingereichten französischen Patentanmeldung beschrieben ist. Diese Entdeckung zeigt, daß man dadurch, daß man ähnliche methodologische Ansätze wie diejenigen, die bei den Arbeiten der Anmelderin an MS verwendet wurden, angewandt hat, ein bei PR exprimiertes Retrovirus, das ebenfalls die bei MS für MSRV-1 beschriebenen Sequenzen aufweist, sowie das gleichzeitige Vorliegen einer assoziierten MSRV-2-Sequenz, die ebenso bei MS beschrieben wird, identifizieren kann. In bezug auf MSRV-1 betreffen die gemeinsam bei MS und bei PR nachgewiesenen Sequenzen die Gene pol und gag. Mit dem gegenwärtigen Wissensstand kann man die beschriebenen Sequenzen gag und pol mit den MSRV-1-Stämmen, die bei diesen beiden Krankheiten exprimiert werden, in Zusammenhang bringen.

Die vorliegende Patentanmeldung betrifft unterschiedliche Ergebnisse, die diejenigen, die bereits in den untenstehenden französischen Patentanmeldungen beschrieben sind, ergänzen:

sowie
  • – die Patentanmeldung WO-97/06260.

Die vorliegende Erfindung betrifft in erster Linie ein Nukleinsäurematerial, das aus einem Retrovirusmaterial im isolierten oder gereinigten Zustand bestehen kann und das auf unterschiedlich Art und Weise festgestellt oder charakterisiert werden kann:

  • – Es umfaßt eine Nukleotidsequenz aus der Gruppe (i) der Sequenzen SEQ ID NO: 114, SEQ ID NO: 117, SEQ ID NO: 120; (ii) die zu den Sequenzen (i) komplementären Sequenzen; sowie (iii) die zu den Sequenzen (i) oder (ii) äquivalenten Sequenzen, insbesondere die Sequenzen, die über eine beliebige Reihe von 100 aufeinanderfolgenden Monomeren mindestens 50%, vorzugsweise mindestens 70% Homologie mit den Sequenzen (i) bzw. (ii) aufweisen;
  • – es codiert für ein Polypeptid, das über eine beliebige aufeinanderfolgende Reihe von mindestens 30 Aminosäuren mindestens 50%, vorzugsweise mindestens 70%, Homologie mit einer Peptidsequenz aus der Gruppe SEQ ID NO: 115, SEQ ID NO: 118, SEQ ID NO: 121 aufweist;
  • – sein env-Gen umfaßt eine Nukleotidsequenz, die mit einer Sequenz aus der Gruppe SEQ ID NO: 117 und seinen komplementären Sequenzen identisch oder äquivalent ist;
  • – sein env-Gen umfaßt eine Nukleotidsequenz, die bei Nukleotid 1 der SEQ ID NO: 117 beginnt und bei Nukleotid 233 der SEQ ID NO: 114 aufhört;
  • – sein env-Gen codiert für ein Polypeptid, das über eine beliebige aufeinanderfolgende Reihe von mindestens 30 Aminosäuren mindestens 50%, vorzugsweise mindestens 70%, Homologie mit der Sequenz SEQ ID NO: 118 aufweist;
  • – die U3R-Region seines 3'-LTR umfaßt eine Nukleotidsequenz, die bei Nukleotid 617 von SEQ ID NO: 114 aufhört;
  • – die RU5-Region des 5'-LTR umfaßt eine Nukleotidsequenz, die bei Nukleotid 755 von SEQ ID NO: 120 beginnt;
  • – eine retrovirale Nukleinsäure, die eine Sequenz, die bei Nukleotid 755 von SEQ ID NO: 120 beginnt und bei Nukleotid 617 von SEQ ID NO: 114 aufhört, umfaßt;
  • – die wie zuvor definierte retrovirale Nukleinsäure ist insbesondere mit mindestens einer Autoimmunerkrankung wie multiple Sklerose oder rheumatoide Polyarthritis assoziiert.

Die Erfindung betrifft auch ein Nukleotidfragment, das mindestens einer der folgenden Definitionen entspricht:

  • – es umfaßt eine bzw. besteht aus einer Nukleotidsequenz aus der Gruppe (i) der Sequenzen SEQ ID NO: 114, SEQ ID NO: 117, SEQ ID NO: 120; (ii) der zu den Sequenzen (i) komplementären Sequenzen; sowie (iii) der zu den Sequenzen (i) oder (ii) äquivalenten Sequenzen, insbesondere den Sequenzen, die über eine beliebige Reihe von 100 aufeinanderfolgenden Monomeren mindestens 50%, vorzugsweise mindestens 70%, Homologie mit den Sequenzen (i) bzw. (ii) aufweisen;
  • – es umfaßt eine bzw. besteht aus einer Nukleotidsequenz, die für ein Polypeptid codiert, das über eine beliebige aufeinanderfolgende Reihe von mindestens 30 Aminosäuren mindestens 50%, vorzugsweise mindestens 70%, Homologie mit einer Peptidsequenz aus der Gruppe SEQ ID NO: 115, SEQ ID NO: 118, SEQ ID NO: 121 aufweist.

Weitere Gegenstände der vorliegenden Erfindung sind:

  • – Nukleinsäuresonde für den Nachweis eines mit multipler Sklerose und/oder rheumatoider Polyarthritis assoziierten Retrovirus, die spezifisch mit einem beliebigen oben definierten Fragment, das zu dem Genom dieses Retrovirus gehört, hybridisieren kann; sie weist vorteilhaft 10 bis 100 Nukleotide, vorzugsweise 10 bis 30 Nukleotide auf;
  • – Primer für die Amplifikation einer RNA oder einer DNA eines mit multipler Sklerose und/oder rheumatoider Polyarthritis assoziierten Retrovirus mittels Polymerisation, wobei dieser Primer eine Nukleotidsequenz umfaßt, die mindestens zu einem Teil der Nukleotidsequenz eines oben definierten Fragments identisch und äquivalent ist, insbesondere eine Nukleotidsequenz, die über eine beliebige Reihe von 10 aufeinanderfolgenden Monomeren mindestens 50%, vorzugsweise mindestens 70%, Homologie mit mindestens diesem Teil dieses Fragments aufweist; vorzugsweise wird die Nukleotidsequenz eines erfindungsgemäßen Primers aus der Gruppe SEQ ID NO: 116 und SEQ ID NO: 119 ausgewählt;
  • – eine RNA- oder DNA, insbesondere ein Replikations- und/oder Expressionsvektor, der ein Genomfragment der Nukleinsäure oder ein oben definiertes Fragment umfaßt;
  • – ein Peptid, das von einem beliebigen offenen Leseraster, das zu einem oben definierten Nukleotidfragment gehört, insbesondere ein Polypeptid, zum Beispiel ein Oligopeptid, das eine antigene Determinante, die von Seren von mit MSRV-1-Virus infizierten Patienten und/oder von Patienten, bei denen das MSRV-1-Virus reaktiviert wurde, erkannt wird, gebildet wird oder diese umfaßt; ein bevorzugtes Peptid umfaßt eine Sequenz, die teilweise oder ganz identisch mit bzw. zu einer Sequenz aus der Reihe SEQ ID NO: 115, SEQ ID NO: 118, SEQ ID NO: 121 ist;
  • – eine diagnostische, prophylaktische oder therapeutische Zusammensetzung, insbesondere für die Hemmung der Expression von mindestens einem Retrovirus, das mit multipler Sklerose und/oder rheumatoider Polyarthritis assoziiert ist, die ein oben definiertes Nukleotidfragment umfaßt;
  • – Verfahren für den Nachweis eines mit multipler Sklerose und/oder rheumatoider Polyarthritis assoziierten Retrovirus in einer biologischen Probe, welches die Schritte umfaßt, daß man eine RNA und/oder eine DNA, von der angenommen wird, daß sie zu diesem Retrovirus gehört oder davon stammt, oder deren komplementäre RNA bzw. DNA mit einer Zusammensetzung, die ein oben definiertes Nukleotidfragment umfaßt, in Kontakt bringt.

Bevor die Erfindung genauer dargelegt wird, werden nun verschiedene Begriffe, die in der Beschreibung und in den Ansprüchen verwendet werden, definiert:

  • – unter "Stamm" oder "Isolat" versteht man jegliche infizierende und/oder pathogene biologische Fraktion, die zum Beispiel Viren und/oder Bakterien und/oder Parasiten enthält und die ein pathogenes und/oder antigenes Potential erzeugt, das von einer Kultur oder einem lebenden Wirt geborgen wird; so kann zum Beispiel ein wie oben definierter Virusstamm ein mitinfizierendes Agens, zum Beispiel einen pathogenen Protisten, enthalten;
  • – der in der vorliegenden Beschreibung verwendete Begriff "MSRV" bezeichnet jegliches pathogene und/oder infizierende Agens, das mit MS assoziiert ist, insbesondere eine Virusart, die attenuierten Stämme dieser Virusart, oder die defizienten Partikel, die interferieren oder miteingekapselte Genome oder auch Genome, die mit einem Teil des MSRV-1-Genoms rekombiniert haben, die sich von dieser Art ableiten, umfassen. Es ist bekannt, daß Viren, insbesondere Viren, die RNA enthalten, im Anschluß insbesondere an relativ hohe spontane Mutationsraten, eine Variabilität aufweisen, was im folgenden für die Definition des Begriffs der Äquivalenz in Betracht gezogen werden wird;
  • – unter menschlichem Virus versteht man ein Virus, das den Menschen infizieren bzw. vom Menschen geborgen werden kann;
  • – in Anbetracht all der natürlichen oder induzierten Variationen und/oder Rekombinationen, die bei der Durchführung der vorliegenden Erfindung gefunden werden können, wurden deren Gegenstände, die oben und in den Ansprüchen definiert sind, unter Umfassung der Äquivalente oder Derivate der verschiedenen im folgenden definierten biologischen Materialien, insbesondere der homologen Nukleotid- oder Peptidsequenzen, ausgedrückt;
  • – die Variante eines erfindungsgemäßen Virus oder pathogenen und/oder infektiösen Agens umfaßt mindestens ein Antigen, das von mindestens einem Antikörper erkannt wird, der gegen mindestens ein Antigen, das diesem Virus und/oder diesem pathogenen und/oder infektiösen Agens entspricht, und/oder gegen ein Genom gerichtet ist, wobei jeglicher Teil davon von mindestens einer Hybridisierungssonde nachgewiesen wird, und/oder mindestens einen Nukleotid-Amplifikationsprimer, der für dieses Virus und/oder pathogene und/oder infektiöse Agens spezifisch ist, unter bestimmten Hybridisierungsbedingungen, die dem Fachmann gut bekannt sind;
  • – erfindungsgemäß ist ein Nukleotidfragment oder ein Oligonukleotid oder ein Polynukleotid eine Aneinanderreihung von Monomeren, oder ein Biopolymer, die bzw. das durch die informationstragende Sequenz der natürlichen Nukleinsäuren charakterisiert ist und fähig ist, mit einem beliebigen anderen Nukleotidfragment unter vorbestimmten Bedingungen zu hybridisieren, wobei die Aneinanderreihung Monomere mit unterschiedlichen chemischen Strukturen enthalten kann und ausgehend von einem natürlichen Nukleinsäuremolekül und/oder durch genetische Rekombination und/oder durch chemische Synthese erhalten werden kann; ein Nukleotidfragment kann mit einem Genomfragment des MSRV-1-Virus, mit dem sich die vorliegende Erfindung befaßt, insbesondere ein Gen des letztgenannten, bei diesem Virus zum Beispiel pol oder env, identisch sein;
  • – so kann ein Monomer ein natürliches Nukleinsäurenukleotid sein, dessen Bausteine ein Zucker, eine Phosphatgruppe und eine Stickstoffbase sind; bei der RNA handelt es sich bei dem Zucker um Ribose, bei der DNA handelt es sich bei dem Zucker um Desoxy-2-ribose; je nachdem, ob es sich um DNA oder RNA handelt, stammt die Stickstoffbase aus der Gruppe Adenin, Guanin, Uracil, Cytosin, Thymin; das Nukleotid kann jedoch auch in mindestens einem der drei Bausteine modifiziert sein; so kann die Modifikation zum Beispiel bei den Basenansätzen, wodurch modifizierten Basen wie Inosin, Methyl-5-desoxycytidin, Desoxyuridin, Dimethylamino-5-desoxyuridin, Diamino-2,6-purin, Brom-5-desoxyuridin und jegliche sonstige modifizierte Basen, die die Hybridisierung begünstigen, geschaffen werden; beim Zucker kann die Modifikation darin bestehen, daß man mindestens eine Desoxyribose durch ein Polyamid ersetzt, und bei der Phosphatgruppe kann die Modifikation darin bestehen, daß man sie durch Ester, insbesondere Ester aus der Gruppe Diphosphatester, Alkyl- und Arylphosphonat sowie Phosphorthioat, ersetzt;
  • – unter "informationstragende Sequenz" versteht man jegliche geordnete Anreihung von Monomeren, deren chemische Natur und Ordnung in einer Bezugsrichtung gegebenenfalls eine funktionsfähige Information von der gleichen Qualität wie der der natürlichen Nukleinsäuren darstellt;
  • – unter Hybridisierung versteht man den Vorgang, bei dem unter entsprechenden Arbeitsbedingungen zwei Nukleotidfragmente mit ausreichend komplementären Sequenzen zu einer komplexen Struktur, insbesondere einer Doppel- oder Dreifachstruktur, vorzugsweise in Form einer Helix, paaren;
  • – eine Sonde umfaßt ein chemisch synthetisiertes oder mittels Verdauung oder enzymatischer Restriktion eines längeren Nukleotidfragments erhaltenes Nukleotidfragment, das mindestens sechs Monomere, vorteilhafterweise 10 bis 100 Monomere, vorzugsweise 10 bis 30 Monomere umfaßt und eine Hybridisierungsspezifität unter bestimmten Bedingungen aufweist; vorzugsweise wird eine Sonde, die weniger als 10 Monomere besitzt, nicht allein verwendet, sondern in Gegenwart von anderen Sonden, die genauso kurz sind oder nicht; unter gewissen spezifischen Bedingungen kann es nützlich sein, Sonden mit einer Größe von über 100 Monomeren zu verwenden; eine Sonde kann insbesondere für diagnostische Zwecke verwendet werden, wobei es sich zum Beispiel um Fang- und/oder Nachweissonden handeln wird;
  • – die Fangsonde kann auf jede beliebige Art und Weise, also direkt oder indirekt, zum Beispiel kovalent oder durch passive Adsorption, auf einem festen Träger immobilisiert sein;
  • – die Nachweissonde kann mit einem Marker, insbesondere aus der Gruppe der radioaktiven Isotope, mit Enzymen, insbesondere aus der Gruppe Peroxidase und alkalische Phosphatase und denjenigen, die ein chromogenes, fluorigenes oder lumineszierendes Substrat zu hydrolysieren vermögen, mit chemischen chromophoren Verbindungen, mit chromogenen, fluorigenen oder lumineszierenden Verbindungen, mit Nukleotidbasenanalogen und mit Biotin markiert sein;
  • – die Sonden, die erfindungsgemäß für diagnostische Zwecke verwendet werden können, können bei allen bekannten Hybridisierungstechniken verwendet werden, insbesondere bei den Techniken, die unter den Bezeichnungen "DOT-BLOT", "SOUTHERN-BLOT", "NORTHERN-BLOT", wobei es sich um eine Technik handelt, die mit der "SOUTHERN-BLOT"-Technik identisch ist, bei der jedoch RNA als Angriffspunkt verwendet wird, die SANDWICH-Technik bekannt sind; vorteilhafterweise verwendet man bei der vorliegenden Erfindung die SANDWICH-Technik, die eine spezifische Fangsonde und/oder spezifische Nachweissonde umfaßt, wobei gilt, daß die Fangsonde und die Nachweissonde eine zumindest teilweise unterschiedliche Nukleotidsequenz aufweisen müssen,
  • – jede erfindungsgemäße Sonde kann in vivo oder in vitro mit RNA und/oder DNA hybridisieren, um Replikationserscheinungen, insbesondere Translation und/oder Transkription, zu blockieren und/oder um diese DNA und/oder RNA abzubauen,
  • – ein Primer ist eine Sonde, die mindestens sechs Monomere, vorteilhafterweise 10 bis 30 Monomere, umfaßt, die eine Hybridisierungsspezifität unter bestimmten Bedingungen aufweisen, mit dem Zweck, eine enzymatische Polymerisation zu initiieren, zum Beispiel bei einer Amplifikationstechnik wie der PCR (Polymerase Chain Reaction), bei einem Elongationsvorgang wie der Sequenzierung, bei einer reversen Transkriptionsmethode oder ähnlichem,
  • – zwei Nukleotid- oder Peptidsequenzen werden als äquivalent oder voneinander abstammend oder von einer Referenzsequenz abstammend bezeichnet, wenn die entsprechenden Biopolymere ohne identisch zu sein bei der jeweiligen Anwendung oder Verwendung oder bei der Technik, an der sie beteiligt sind, im wesentlichen die gleiche Rolle spielen können; Sequenzen, die insbesondere äquivalent sind, sind zwei Sequenzen, die aufgrund der natürlichen Variabilität erhalten wurden, insbesondere aufgrund der spontanen Mutation der Art, aus der sie identifiziert worden sind, oder aufgrund induzierter Mutation, sowie zwei homologe Sequenzen, wobei Homologie im folgenden definiert wird,
  • – unter "Variabilität" versteht man jegliche spontane oder induzierte Modifikation einer Sequenz, insbesondere durch Substitution und/oder Insertion und/oder Deletion von Nukleotiden und/oder Nukleotidfragmenten, und/oder Verlängerung und/oder Verkürzung der Sequenz an mindestens einem Ende; eine unnatürliche Variabilität kann das Ergebnis der verwendeten Gentechnikmethoden sein, zum Beispiel das Ergebnis der Auswahl von degenerierten oder nicht degenerierten synthetischen Primern, die für die Amplifikation einer Nukleinsäure gewählt wurden; diese Variabilität kann sich in Modifikationen in einer beliebigen Ausgangssequenz, die als Referenz aufgefaßt wird, äußern und kann durch einen Homologiegrad in bezug auf diese Referenzsequenz ausgedrückt werden,
  • – die Homologie charakterisiert den Grad der Identität von zwei Nukleotid- oder Peptidfragmenten, die verglichen werden; sie wird mit dem Prozentsatz der Identität, die insbesondere durch direkten Vergleich von Nukleotid- oder Peptidsequenzen in bezug auf Referenznukleotid- oder -peptidsequenzen bestimmt wird, gemessen,
  • – ein Nukleotidfragment wird als einem Referenzfragment äquivalent bzw. von einem Referenzfragment abgeleitet bezeichnet, wenn es eine Nukleotidsequenz aufweist, die zu der Referenzfragmentsequenz äquivalent ist; gemäß der obigen Definition sind die folgenden insbesondere äquivalent zu einem Referenznukleotidfragment:

    (a) ein Fragment, das zumindest teilweise mit der Komplementärsequenz des Referenzfragments hybridisieren kann,

    (b) ein Fragment, dessen Alignment mit dem Referenzfragment zum Nachweis von mehr identischen aufeinanderfolgenden Basen führt als mit einem beliebigen anderen Fragment, das von einer anderen taxonomischen Gruppe stammt,

    (c) ein Fragment, das das Ergebnis der natürlichen Variabilität der Art, von der es stammt, ist oder sein kann,

    (d) ein Fragment, das das Ergebnis von auf das Referenzfragment angewandte Gentechnikmethoden sein kann,

    (e) ein Fragment, das mindestens acht aufeinanderfolgende Nukleotide enthält und das für ein Peptid codiert, das mit dem von dem Referenzfragment codierten Peptid homolog oder dazu identisch ist,

    (f) ein Fragment, das sich von dem Referenzfragment durch Insertion, Deletion, Substitution von mindestens einem Monomer, Verlängerung oder Verkürzung an mindestens einem seiner Enden unterscheidet; zum Beispiel ein Fragment, das dem Referenzfragment, das an mindestens einem seiner Enden von einer Nukleotidsequenz, die nicht für ein Polypeptid codiert, flankiert ist, entspricht,
  • – unter Polypeptid versteht man insbesondere ein beliebiges Peptid aus mindestens zwei Aminosäuren, insbesondere ein Oligopeptid oder Protein, das durch menschliche Manipulation extrahiert, abgetrennt oder im wesentlichen isoliert oder synthetisiert wird, insbesondere diejenigen, die durch chemische Synthese oder durch Expression in einem rekombinanten Organismus erhalten werden,
  • – unter "Polypeptid, das teilweise von einem Nukleotidfragment codiert wird" versteht man ein Polypeptid, das mindestens drei Aminosäuren aufweist, die von mindestens neun aufeinanderfolgenden Monomeren, die in diesem Nukleotidfragment enthalten sind, codiert werden,
  • – eine Aminosäure wird als analog zu einer anderen Aminosäure bezeichnet, wenn ihre jeweiligen chemisch-physikalischen Eigenschaften wie Polarität, Hydrophobität und/oder Alkalität und/oder Azidität und/oder Neutralität im wesentlichen gleich sind; so ist ein Leucin zu einem Isoleucin analog,
  • – ein Polypeptid wird als äquivalent zu einem Referenzpolypeptid bzw. davon abgeleitet bezeichnet, wenn die Polypeptide, die verglichen werden, im wesentlichen die gleichen Eigenschaften, insbesondere die gleichen antigenen Eigenschaften, immunologischen Eigenschaften, enzymologischen Eigenschaften und/oder Eigenschaften der molekularen Erkennung, aufweisen; die folgenden sind insbesondere zu einem Referenzpolypeptid äquivalent:

    (a) ein Polypeptid, das eine Sequenz aufweist, bei der mindestens eine Aminosäure durch eine analoge Aminosäure substituiert worden ist,

    (b) ein Polypeptid mit einer äquivalenten Peptidsequenz, das durch natürliche oder induzierte Variation dieses Referenzpolypeptids und/oder des Nukleotidfragments, das für dieses Polypeptid codiert, erhalten wird,

    (c) ein Mimotop dieses Referenzpolypeptids,

    (d) ein Polypeptid, in dessen Sequenz eine oder mehrere Aminosäuren der Reihe L durch eine Aminosäure der Reihe D ersetzt sind und umgekehrt,

    (e) Ein Polypeptid, in dessen Sequenz eine Modifikation der Seitenketten der Aminosäuren eingeführt worden ist, wie zum Beispiel eine Acetylierung der Aminofunktion, eine Carboxylierung der Thiolfunktionen, eine Veresterung der Carbonsäurefunktionen,

    (f) ein Polypeptid, in dessen Sequenz eine oder mehrere Peptidbindungen modifiziert worden sind, wie zum Beispiel Carba-Bindungen, Retro-Bindungen, Reverso-Bindungen, Retro-Reverso-Bindungen, reduzierte Bindungen sowie Methylenoxy-Bindungen,

    (g) ein Polypeptid, bei dem mindestens ein Antigen von Antikörpern, die gegen ein Referenzpolypeptid gerichtet sind, erkannt wird,
  • – der Prozentsatz der Identität, der die Homologie von zwei Peptidfragmenten, die verglichen werden, charakterisiert, beträgt erfindungsgemäß mindestens 50%, vorzugsweise mindestens 70%.

In Anbetracht dessen, daß ein Virus mit der enzymatischen Aktivität einer reversen Transkriptase genetisch sowohl in RNA-Form als auch in DNA-Form charakterisiert werden kann, wird sowohl auf virale DNA als auch auf virale RNA für die Charakterisierung der Sequenzen, die sich auf ein Virus beziehen, das eine solche reverse Transkriptase-Aktivität aufweist, erfindungsgemäß MSRV-1 genannt, Bezug genommen werden.

Die in der vorliegenden Beschreibung und in den Ansprüchen verwendeten Ordnungsbezeichnungen wie "erste Nukleotidsequenz" werden nicht gewählt, um eine bestimmte Ordnung zu bezeichnen, sondern um die Erfindung deutlicher zu definieren.

Unter Nachweis einer Substanz oder eines Agens versteht man im folgenden Text nicht nur eine Identifikation, sondern auch eine quantitative Bestimmung oder eine Abtrennung oder Isolation von dieser Substanz oder diesem Agens.

Die Erfindung wird beim Durchlesen der folgenden detaillierten Beschreibung, die auf die beigelegten Abbildungen Bezug nimmt, besser verstanden werden, wobei die Abbildungen folgendes darstellen:

1 stellt die allgemeine Struktur der proviralen DNA und der genomischen RNA von MSRV-1 dar.

2 stellt die Nukleotidsequenz des Klons mit der Bezeichnung CL6-5' (SEQ ID NO: 112) und drei mögliche Leseraster in Aminosäuren, die unter der Nukleotidsequenz stehen, dar.

3 stellt die Nukleotidsequenz des Klons mit der Bezeichnung CL6-3' (SEQ ID NO: 114) und drei mögliche Leseraster in Aminosäuren, die unter der Nukleotidsequenz stehen, dar.

4 stellt die Nukleotidsequenz des Klons mit der Bezeichnung C15 (SEQ ID NO: 117) und drei mögliche Leseraster in Aminosäuren, die unter der Nukleotidsequenz stehen, dar.

5 stellt die Nukleotidsequenz des Klons mit der Bezeichnung 5M6 (SEQ ID NO: 120) und drei mögliche Leseraster in Aminosäuren, die unter der Nukleotidsequenz stehen, dar.

6 stellt die Nukleotidsequenz des Klons mit der Bezeichnung CL2 (SEQ ID NO: 130) und drei mögliche Leseraster in Aminosäuren, die unter der Nukleotidsequenz stehen, dar.

7 stellt drei mögliche Leseraster in Aminosäuren, die von dem pET28C-Klon 2 exprimiert werden, und die unter der Nukleotidsequenz stehen, dar.

8 stellt drei mögliche Leseraster in Aminosäuren, die von dem pET21C-Klon 2 exprimiert werden, und die unter der Nukleotidsequenz stehen, dar.

9 stellt die Nukleotidsequenz des Klons mit der Bezeichnung LB13 (SEQ ID NO: 141) und drei mögliche Leseraster in Aminosäuren, die unter der Nukleotidsequenz stehen, dar.

10 stellt die Nukleotidsequenz des Klons mit der Bezeichnung LA15 (SEQ ID NO: 142) und drei mögliche Leseraster in Aminosäuren, die unter der Nukleotidsequenz stehen, dar.

11 stellt die Nukleotidsequenz des Klons mit der Bezeichnung LB16 (SEQ ID NO: 124) und drei mögliche Leseraster in Aminosäuren, die unter der Nukleotidsequenz stehen, dar.

12 stellt die in cpm/4 min ausgedrückte Promoteraktivität der U3R-Sequenzen, die ausgehend von LTRs unterschiedlicher Herkunft in das Plasmid PCAT3 subkloniert wurden, dar. PCAT3 bedeutet nur Plasmid, PCAT-PH74 bedeutet Plasmid plus Klon U3Rendogène, exprimiert in der Plazenta, PCAT-c16 bedeutet Plasmid plus Klon U3R, amplifiziert in der RNA eines MS-Plasma, PCAT-5M6 bedeutet Plasmid plus U3R-Region, amplifiziert in Zell-DNA, "no plasmid" bedeutet, daß kein Plasmid in dem Test vorhanden ist.

13 stellt die MSRV1-Sequenz env und LTR 3' dar. Die waagerechten Zeilen geben den Beginn der Regionen env, U3 und R an. In der Region env sind das Peptidsignal und die potentielle immunsuppressive Region unterstrichen, die potentiellen Glykosylierungsstellen eingerahmt und die potentiellen Restriktionsschnittstellen sind durch senkrechte Pfeile angegeben. In der U3R-Region sind das CAAT-Regulationselement und die TATA-Box unterstrichen, die "cap"-Stelle und das Polyadenylierungssignal sind ebenfalls angegeben.

14 stellt eine LTR 5'-Region (RU5) dar, auf die eine PBS (primer binding site)-Stelle, die zu der Trp-tRNA komplementär ist, und ein gag-Gen, das für ein Protein mit ungefähr 487 Aminosäuren codiert, folgt. Die in dem Nukleocapsid konservierten Aminosäuren sind doppelt unterstrichen. Die Aminosäuren, die die Region mit der stärksten Homologie in dem Capsid definieren, sind fettgedruckt und einfach unterstrichen. Die "/" in der Aminosäuresequenz geben Variationen, die bei den Klonen und in der Nukleotidsequenz zu finden sind, an, sie geben Leserasterverschiebungen in gewissen Klonen an. Die eingerahmten Regionen entsprechen Epitopen, die mittels Peptidanalyse der C-terminalen Region identifiziert wurden.

15 stellt die Integraseregion MSRV1, die Nukleotidsequenz und die von der Integraseregion abgeleitete Aminosäuresequenz entsprechend Klon 87–23 dar. In 15 bedeutet "//" eine Leserasterverschiebung, die zwecks Restitution des potentiellen ORF supprimiert wurde. Die unterstrichenen fettgedruckten Buchstaben bedeuten die konservierten Aminosäuren von Retrovirus-Integrasen.

16 beschreibt die Nukleotid-und Peptidsequenz von Klon B13 (der mit dem in früheren Anmeldungen beschriebenen Klon FBd13 identisch ist), wobei ORFs und Stop-Codons durch einen Punkt dargestellt sind. Die fettgedruckte unterstrichene Region stellt die potentielle Immunsuppressionsdomäne dar. Die einfach unterstrichene Domäne stellt den Anfang von LTR 3' dar.

BEISPIEL 1: GEWINNUNG EINER REGION A CL6-5', DIE FÜR DAS N-TERMINALE ENDE DER INTEGRASE CODIERT, SOWIE EINER REGION CL6-3', DIE DIE 3'-TERMINALE SEQUENZ DES MSRV-1-GENOMS ENTHÄLT

Mit einem Gesamt-RNA-Extrakt von Plasma eines MS-Patienten wurde eine 3'-RACE durchgeführt. Als Negativkontrolle wurde ein gesundes Vergleichsplasma, das unter den gleichen Bedingungen behandelt wurde, verwendet. Die cDNA-Synthese wurde mit einem Oligo-dT-Primer, mit der Bezeichnung SEQ ID NO: 68 (5' GAC TCG CTG CAG ATC GAT TTT TTT TTT TTT TTT T 3') und der reversen Transkriptase "ExpandTM RT" von Boehringer unter den von der Firma empfohlenen Bedingungen durchgeführt. Eine PCR wurde mit Klentaq-Enzym (Clontech) unter den folgenden Bedingungen durchgeführt: 5 Minuten bei 94°C, anschließend 1 Minute bei 93°C, 1 Minute bei 58°C, 3 Minuten bei 68°C über 40 Zyklen und 8 Minuten bei 68°C, wobei das Endreaktionsvolumen 50 &mgr;l betrug.

Für die PCR verwendete Primer:

  • – 5'-Primer, mit der Bezeichnung SEQ ID NO: 69

    5' GCC ATC AAG CCA CCC AAG AAC TCT TAA CTT 3';
  • – 3'-Primer, mit der Bezeichnung SEQ ID NO: 68

Eine zweite, sogenannte "semi-nested" PCR, wurde mit einem 5'-Primer, der innerhalb der bereits amplifizierten Region lag, durchgeführt. Diese zweite PCR wurde unter den gleichen Versuchsbedingungen wie denjenigen, die bei der ersten PCR verwendet wurden, angewandt, und zwar unter Verwendung von 10 &mgr;l Amplifikationsprodukt aus der ersten PCR.

Primer, die für die "half-nested" PCR verwendet wurden:

  • – 5'-Primer, mit der Bezeichnung SEQ ID NO: 70

    5' CCA ATA GCC AGA CCA TTA TAT ACA CTA ATT 3';
  • – 3'-Primer, mit der Bezeichnung SEQ ID NO: 68

Die Primer SEQ ID NO: 69 und SEQ ID NO: 70 sind für die pol-Region von MRSV-1 spezifisch.

Von dem Plasma des MS-Patienten wurde ein 1,9 Kb großes Amplifikationsprodukt gewonnen. Bei dem gesunden Kontrollplasma wurde das entsprechende Fragment nicht beobachtet. Dieses Amplifikationsprodukt wurde folgendermaßen kloniert:

Die amplifizierte DNA wurde mit Hilfe des "TA Cloning®"-Kits in ein Plasmid insertiert. Die 2 &mgr;l DNA-Lösung wurden mit 5 &mgr;l sterilem destilliertem Wasser, 1 &mgr;l eines 10fach konzentrierten Ligationspuffers mit der Bezeichnung "10X LIGATION BUFFER", 2 &mgr;l "pCRTM VECTOR" (25 ng/ml) sowie 1 &mgr;l "T4 DNA LIGASE" vermischt. Diese Mischung wurde 1 Nacht bei 12°C inkubiert. Die folgenden Schritte wurden entsprechend den Anweisungen des "TA Cloning®"-Kits (Invitrogen) durchgeführt. Am Ende des Vorgangs wurden die weißen Kolonien der rekombinanten Bakterien (white) vereinzelt und anschließend kultiviert und damit eine Extraktion der aufgenommenen Plasmide nach dem sogenannten "Miniprep"-Verfahren durchgeführt. Das Plasmidpräparat von jeder rekombinanten Kolonie wurde mit einem entsprechenden Restriktionsenzym geschnitten und auf Agarosegel analysiert. Die Plasmide mit einem Insert, das nach Markierung des Gels mit Ethidiumbromid unter UV-Licht nachgewiesen wurde, wurden nach Hybridisierung mit einem komplementären Primer des auf dem Klonierungsplasmid des "TA Cloning®"-Kit vorhandenen Sp6-Promoters auf die Sequenzierung des Inserts selektiert. Die Reaktion vor der Sequenzierung wurde dann nach dem empfohlenen Verfahren für die Verwendung des Sequenzierkits "PRISMTM Ready Reaction Amplitaq® FS, DyeDeoxyTM Terminator" (Applied Biosystems, ref. 402119) durchgeführt, und die automatische Sequenzierung wurde gemäß den Anweisungen des Herstellers an den Geräten 373 A und 377 Applied Biosystems durchgeführt.

Der erhaltene Klon enthält eine Region CL6-5', die für das N-terminale Ende der Integrase codiert, sowie eine Region CL6-3', die der 3' terminalen Region von MSRV-1 entspricht, wodurch man das Ende der Hülle (234 Bp) und die Regionen U3, R (401 Bp) des Retrovirus MSRV1 definieren kann.

Die Region, die dem N-terminalen Ende der Integrase entspricht, ist anhand ihrer Nukleotidsequenz (SEQ ID No: 112) in 2 dargestellt. Die drei potentiellen Leseraster sind mit ihrer Aminosäuresequenz unter der Nukleotidsequenz dargestellt, und die Aminosäuresequenz des N-terminalen Endes der Integrase trägt die Bezeichnung SEQ ID NO: 113.

Die Region C16-3' ist anhand ihrer Nukleotidsequenz (SEQ ID No: 114) in 3 dargestellt. Die drei potentiellen Leseraster sind mit ihrer Aminosäuresequenz unter der Nukleotidsequenz dargestellt. Eine Aminosäuresequenz, die dem C-terminalen Ende des env-Proteins von MSRV-1 entspricht, trägt die Bezeichnung SEQ ID No: 115.

Zur Auswertung der Promoteraktivität des ausgehend von Klon 6 (cl6) erhaltenen LTR wurde mit der entsprechenden U3R-Region ein Promoteraktivitätstest durchgeführt, bei dem das Enzym CAT (Chloramphenicolacetyltransferase) verwendet wurde. Parallel dazu wurden ein Klon, der dieselbe U3R-Region von endogener retroviraler RNA, die in der normalen Plazenta exprimiert wurde (PH74) sowie ein Klon (5M6), der von DNA abstammt, getestet. Das in 12 dargestellte Ergebnis zeigt eine sehr starke Promoteraktivität des LTR von MS-Plasma (c16) und eine signifikant wesentlich schwächere Aktivität für die Nicht-MS-Sequenzen endogenen Ursprungs.

BEISPIEL 2: GEWINNUNG DES KLONS C15, DER DIE FÜR EINEN TEIL DER HÜLLE DES RETROVIRUS MSRV-1 CODIERENDE REGION ENTHÄLT

Mit Gesamt-RNA-Extrakt von Virionen, die mittels Ultrazentrifugation ausgehend von einem Kulturüberstand von Synoviozyten eines PR-Patienten konzentriert wurden, wurde eine RT-PCR durchgeführt. Die cDNA-Synthese wurde mit einem Oligo-dT-Primer und der reversen Transkriptase "ExpandTM RT" von Boehringer unter den von der Firma empfohlenen Bedingungen durchgeführt. Mit dem ExpandTM Long Template PCR System (Boehringer) wurde unter den folgenden Bedingungen eine PCR durchgeführt: 5 Minuten bei 94°C, anschließend 1 Minute bei 93°C, 1 Minute bei 60°C, 3 Minuten bei 68°C über 40 Zyklen und 8 Minuten bei 68°C, wobei das Endreaktionsvolumen 50 &mgr;l betrug.

Für die PCR verwendete Primer:

  • – 5'-Primer, mit der Bezeichnung SEQ ID NO: 69

    5' GCC ATC AAG CCA CCC AAG AAC TCT TAA CTT 3';
  • – 3'-Primer, mit der Bezeichnung SEQ ID NO: 116

    5' TGG GGT TCC ATT TGT AAG ACC ATC TGT AGC TT 3'

Eine zweite, sogenannte "semi-nested" PCR, wurde mit einem 5' Primer, der sich im Inneren der bereits amplifizierten Region befand, durchgeführt. Diese zweite PCR wurde unter den gleichen Versuchsbedingungen wie denen, die bei der ersten PCR angewandt wurden, durchgeführt (mit dem Unterschied, daß statt 40 Zyklen 30 durchgeführt wurden), wobei 10 &mgr;l des Amplifikationsprodukts aus der ersten PCR verwendet wurden.

Primer, die für die "semi-nested" PCR verwendet wurden:

  • – 5'-Primer, mit der Bezeichnung SEQ ID NO: 70

    5' CCA ATA GCC AGA CCA TTA TAT ACA CTA ATT 3';
  • – 3'-Primer, mit der Bezeichnung SEQ ID NO: 116

Die Primer SEQ ID NO: 69 und SEQ ID NO: 70 sind für die pol-Region von MRSV-1 spezifisch. Der Primer von SEQ ID NO: 116 ist für die Sequenz FBd13 (auch B13 genannt) spezifisch und in der bei den Oncoretroviren konservierten env-Region lokalisiert.

Ein 1932 Bp großes Amplifikationsprodukt wurde erhalten und folgendermaßen kloniert:

Die amplifizierte DNA wurde mit Hilfe des TA Cloning®-Kits in ein Plasmid insertiert. Die verschiedenen Schritte wurden entsprechend den Anweisungen des TA Cloning®-Kits (Invitrogen) durchgeführt. Am Ende des Vorgangs wurden die weißen Kolonien der rekombinanten Bakterien (white) vereinzelt und anschließend kultiviert und damit eine Extraktion der aufgenommenen Plasmide nach dem sogenannten "Miniprep"-Verfahren durchgeführt. Das Plasmidpräparat von jeder rekombinanten Kolonie wurde mit einem entsprechenden Restriktionsenzym geschnitten und auf Agarosegel analysiert. Die Plasmide mit einem Insert, das nach Markierung des Gels mit Ethidiumbromid unter UV-Licht nachgewiesen wurde, wurden nach Hybridisierung mit einem komplementären Primer des auf dem Klonierungsplasmid des TA Cloning®-Kits vorhandenen SP6-Promoters auf die Sequenzierung des Inserts selektiert. Die Reaktion vor der Sequenzierung wurde dann nach dem empfohlenen Verfahren für die Verwendung des Sequenzierkits "PRISMTM Ready Reaction Amplitaq® FS, DyeDeoxyTM Terminator" (Applied Biosystems, ref. 402119) durchgeführt, und die automatische Sequenzierung wurde gemäß den Anweisungen des Herstellers an den Geräten 373 A und 377 Applied Biosystems durchgeführt.

Der erhaltene Klon C15 enthält eine Region, die der 1481 Bp großen Region der Hülle von MSRV-1 entspricht.

Die env-Region des Klons C15 ist anhand ihrer Nukleotidsequenz (SEQ ID NO: 117) in 5 dargestellt. Die drei potentiellen Leseraster dieses Klons sind anhand ihrer Aminosäuresequenz unter der Nukleotidsequenz dargestellt. Das Leseraster, das einem env-Strukturprotein von MSRV-1 entspricht, trägt die Bezeichnung SEQ ID NO: 118.

Ausgehend von definierten Sequenzen, die von den Klonen cl6 und C15 stammen, konnte ein Plasmidkonstrukt hergestellt werden, das für eine vollständige Hülle und im Anschluß daran das 3'-LTR codiert, wie dies in 13 mit dem entsprechenden Leseraster dargestellt ist.

BEISPIEL 3: GEWINNUNG EINES KLONS 5M6, DER DIE SEQUENZEN DER 3'-TERMINALEN REGION DER HÜLLE UND IM ANSCHLUß DARAN DIE SEQUENZEN U3, R, U5 DES MSRV-1-PROVIRUS-TYPS ENTHÄLT

Mit DNA-Extrakt von B-Lymphozyten eines PR-Patienten, die in Kultur immortalisiert worden waren, wurde eine einfache PCR durchgeführt. Die PCR wurde mit dem ExpandTM Long Template PCR System (Boehringer) unter den folgenden Bedingungen durchgeführt: 3 Minuten bei 94°C, anschließend 1 Minute bei 93°C, 1 Minute bei 60°C, 3 Minuten bei 68°C über 10 Zyklen, anschließend 1 Minute bei 93°C, 1 Minute bei 60°C mit 15 Sekunden Verlängerung in jedem Zyklus, 3 Minuten bei 68°C über 35 Zyklen sowie 7 Minuten bei 68°C mit einem Gesamtreaktionsvolumen von 50 &mgr;l.

Der für die PCR verwendete Primer mit der Bezeichnung SEQ ID NO: 119 ist 5' TCA AAA TCG AAG AGC TTT AGA CTT GCT AAC CG 3';

Der Primer SEQ ID NO: 119 ist für die env-Region des Klons C15 spezifisch.

Ein 1673 Bp großes Amplifikationsprodukt wurde erhalten und folgendermaßen kloniert:

Die amplifizierte DNA wurde mit Hilfe des TA Cloning®-Kits in ein Plasmid insertiert. Die verschiedenen Schritte wurden entsprechend den Anweisungen des TA Cloning®-Kits (Invitrogen) durchgeführt. Am Ende des Vorgangs wurden die weißen Kolonien der rekombinanten Bakterien (white) vereinzelt und anschließend kultiviert und damit eine Extraktion der aufgenommenen Plasmide nach dem sogenannten "Miniprep"-Verfahren durchgeführt. Das Plasmidpräparat von jeder rekombinanten Kolonie wurde mit einem entsprechenden Restriktionsenzym geschnitten und auf Agarosegel analysiert. Die Plasmide mit einem Insert, das nach Markierung des Gels mit Ethidiumbromid unter UV-Licht nachgewiesen wurde, wurden nach Hybridisierung mit einem komplementären Primer des auf dem Klonierungsplasmid des TA Cloning®-Kits vorhandenen SP6-Promoters auf die Sequenzierung des Inserts selektiert. Die Reaktion vor der Sequenzierung wurde dann nach dem empfohlenen Verfahren für die Verwendung des Sequenzierkits "PRISMTM Ready Reaction Amplitaq® FS, DyeDeoxyTM Terminator" (Applied Biosystems, ref. 402119) durchgeführt, und die automatische Sequenzierung wurde gemäß den Anweisungen des Herstellers an den Geräten 373 A und 377 Applied Biosystems durchgeführt.

Der erhaltene Klon 5M6 enthält eine Region, die der 492 Bp großen 3'-Region der Hülle von MSRV-1 entspricht und im Anschluß daran die Regionen U3, R und U5 (837 Bp) von MSRV1.

Der Klon 5M6 ist anhand seiner Nukleotidsequenz (SEQ ID NO: 120) in 5 dargestellt. Die drei potentiellen Leseraster dieses Klons sind anhand ihrer Aminosäuresequenz unter der Nukleotidsequenz dargestellt. Das Leseraster, das dem C-terminalen Ende des env-Proteins von MSRV-1 entspricht, trägt die Bezeichnung SEQ ID NO: 121.

BEISPIEL 4: GEWINNUNG DES KLONS LB16, DER DIE FÜR DIE INTEGRASE DES RETROVIRUS MSRV-1 CODIERENDE REGION ENTHÄLT

Mit Gesamt-RNA, die mit DNAseI behandelt worden war und von einem Plexus choroideus eines MS-Patienten extrahiert worden war, wurde eine RT-PCR durchgeführt. Die cDNA-Synthese wurde mit einen Oligo-dT-Primer und der reversen Transkriptase "ExpandTM RT" von Boehringer unter den von der Firma empfohlenen Bedingungen durchgeführt. Eine "no RT"-Kontrolle wurde parallel dazu mit dem gleichen Material durchgeführt. Eine PCR wurde mit Taq-Polymerase (Perkin Elmer) unter den folgenden Bedingungen durchgeführt: 5 Minuten bei 95°C, anschließend 1 Minute bei 95°C, 1 Minute bei 55°C, 2 Minuten bei 72°C über 35 Zyklen und 8 Minuten bei 72°C, mit einem Reaktionsendvolumen von 50 &mgr;l.

Für die PCR verwendete Primer:

  • – 5'-Primer mit der Bezeichnung SEQ ID NO: 122

    5' GGC ATT GAT AGC ACC CAT CAG 3';
  • – 3'-Primer mit der Bezeichnung SEQ ID NO: 123

    5' CAT GTC ACC AGG GTG GAA TAG 3'

Der Primer SEQ ID NO: 122 ist für die pol-Region von MSRV-1 spezifisch und weist genauer gesagt Ähnlichkeit mit der oben beschriebenen Integraseregion auf. Der Primer SEQ ID NO: 123 wurde an Klonsequenzen, die in Vorversuchen erhalten wurden, definiert.

Ein ungefähr 760 Bp großes Amplifikationsprodukt wurde nur in dem Versuch mit RT erhalten und wurde folgendermaßen kloniert:

Die amplifizierte DNA wurde mit Hilfe des TA Cloning®-Kits in ein Plasmid insertiert. Die verschiedenen Schritte wurden entsprechend den Anweisungen des TA Cloning®-Kits (Invitrogen) durchgeführt. Am Ende des Vorgangs wurden die weißen Kolonien der rekombinanten Bakterien (white) vereinzelt und anschließend kultiviert und damit eine Extraktion der aufgenommenen Plasmide nach dem sogenannten "Miniprep"-Verfahren durchgeführt. Das Plasmidpräparat von jeder rekombinanten Kolonie wurde mit einem entsprechenden Restriktionsenzym geschnitten und auf Agarosegel analysiert. Die Plasmide mit einem Insert, das nach Markierung des Gels mit Ethidiumbromid unter UV-Licht nachgewiesen wurde, wurden nach Hybridisierung mit einem komplementären Primer des auf dem Klonierungsplasmid des TA Cloning®-Kits vorhandenen T7-Promoters auf die Sequenzierung des Inserts selektiert. Die Reaktion vor der Sequenzierung wurde dann nach dem empfohlenen Verfahren für die Verwendung des Sequenzierkits "PRISMTM Ready Reaction Amplitaq® FS, DyeDeoxyTM Terminator" (Applied Biosystems, ref. 402119) durchgeführt, und die automatische Sequenzierung wurde gemäß den Anweisungen des Herstellers an den Geräten 373 A und 377 Applied Biosystems durchgeführt.

Der erhaltene Klon LB16 enthält die Sequenzen, die der Integrase entsprechen. Die Nukleotidsequenz dieses Klons ist in 11 mit der Bezeichnung SEQ ID NO: 124 versehen, drei Leseraster sind angegeben.

BEISPIEL 5: GEWINNUNG EINES KLONS 2, CL2, DER IN 3' EINEN ABSCHNITT MIT HOMOLOGIE ZU DEM POL-GEN, DAS DEM PROTEASEGEN, UND ZU DEM GAG-GEN (GM3), DAS DEM NUKLEOCAPSID ENTSPRICHT, SOWIE EINE NEUE 5'-CODIERREGION, DIE DEM GAG-GEN SOWIE SPEZIFISCH DER MATRIX UND DEM CAPSID VON MSRV-1 ENTSPRICHT, ENTHÄLT.

Mit Gesamt-RNA, die aus 100 &mgr;l Plasma eines MS-Patienten extrahiert worden war, wurde eine PCR-Amplifikation durchgeführt. Als Negativkontrolle wurde eine Wasserkontrolle, die unter den gleichen Bedingungen behandelt wurde, verwendet. Die cDNA-Synthese wurde mit 300 pmol eines Zufallsprimers (GIBCO-BRL, Frankreich) und der reversen Transkriptase "Expand RT" von (BOEHRINGER MANNHEIM, Frankreich) unter den von der Firma empfohlenen Bedingungen durchgeführt. Mit dem Enzym Taq-Polymerase (Perkin Elmer, Frankreich) wurde mit 10 &mgr;l cDNA eine PCR-Amplifikation ("polymerase chain reaction") durchgeführt, und zwar unter den folgenden Bedingungen: 2 Minuten bei 94°C, 1 Minute bei 55°C, 2 Minuten bei 72°C und anschließend 1 Minute bei 94°C, 1 Minute bei 55°C, 2 Minuten bei 72°C über 30 Zyklen und 7 Minuten bei 72°C, mit einem Reaktionsendvolumen von 50 &mgr;l.

Primer, die für die Amplifikation mittels PCR verwendet wurden:

  • – 5'-Primer mit der Bezeichnung SEQ ID NO: 126

    5' CGG ACA TCC AAA GTG ATG GGA AAC G 3';
  • – 3'-Primer mit der Bezeichnung SEQ ID NO: 127

    5' GGA CAG GAA AGT AAG ACT GAG AAG GC 3'

Eine zweite, sogenannte "semi-nested" PCR, wurde mit einem 5' Primer, der sich im Inneren der bereits amplifizierten Region befand, durchgeführt. Diese zweite PCR wurde unter den gleichen Versuchsbedingungen wie denen, die bei der ersten PCR angewandt wurden, durchgeführt, wobei 10 &mgr;l des Amplifikationsprodukts aus der ersten PCR verwendet wurden.

Primer, die für die "semi-nested" PCR verwendet wurden:

  • – 5'-Primer mit der Bezeichnung SEQ ID NO: 128

    5' CCT AGA ACG TAT TCT GGA GAA TTG GG 3';
  • – 3'-Primer mit der Bezeichnung SEQ ID NO: 129

    5' TGG CTC TCA ATG GTC AAA CAT ACC CG 3'

Die Primer SEQ ID NO: und SEQ ID NO: sind für die pol-Region, Klon G+E+A, spezifisch und stärker spezifisch für die Region E: Nukleotidposition Nr. 423 bis Nr. 448. Die in der 5'-Region verwendeten Primer wurden an Sequenzen von Klonen, die in Vorversuchen erhalten wurden, definiert.

Ausgehend von der RNA-, die vom Plasma des MS-Patienten extrahiert worden war, wurde ein 1511 Bp großes Amplifikationsprodukt erhalten. Das entsprechende Fragment wurde bei der Wasserkontrolle nicht beobachtet. Dieses Amplifikationsprodukt wurde folgendermaßen kloniert.

Die amplifizierte DNA wurde mit Hilfe des "TA Cloning®"-Kits in ein Plasmid insertiert. Die 2 &mgr;l DNA-Lösung wurden mit 5 &mgr;l sterilem distilliertem Wasser, 1 &mgr;l eines 10fach konzentrierten Ligationspuffers mit der Bezeichnung "10X LIGATION BUFFER", 2 &mgr;l "pCRTM VECTOR" (25 ng/ml) sowie 1 &mgr;l "T4 DNA LIGASE" vermischt. Diese Mischung wurde 1 Nacht bei 14°C inkubiert. Die folgenden Schritte wurden entsprechend den Anweisungen des "TA Cloning®"-Kits (Invitrogen) durchgeführt. Nach Transformation der Ligation in E. coli INV&agr;F'-Bakterien wurde die Mischung ausgestrichen. Am Ende des Vorgangs wurden die weißen Kolonien der rekombinanten Bakterien vereinzelt und anschließend kultiviert und damit eine Extraktion der aufgenommenen Plasmide nach dem sogenannten "DNA-Minipräparation"(17)-Verfahren durchgeführt. Das Plasmidpräparat von jeder rekombinanten Kolonie wurde mit dem Restriktionsenzym Eco RI geschnitten und auf Agarosegel analysiert. Die Plasmide mit einem Insert, das nach Markierung des Gels mit Ethidiumbromid unter UV-Licht nachgewiesen wurde, wurden nach Hybridisierung mit einem komplementären Primer des auf dem Klonierungsplasmid des "TA Cloning-Kits®" vorhandenen T7-Promoters auf die Sequenzierung des Inserts selektiert. Die Reaktion vor der Sequenzierung wurde dann nach dem empfohlenen Verfahren für die Verwendung des Sequenzierkits "PRISMTM Ready Reaction Amplitaq® FS, DyeDeoxyTM Terminator" (Applied Biosystems, ref. 402119) durchgeführt, und die automatische Sequenzierung wurde gemäß den Anweisungen des Herstellers an den Geräten 373 A und 377 Applied Biosystems durchgeführt.

Der erhaltene Klon, der mit der Bezeichnung CL2 versehen wird, enthält eine C-terminale Region, die eine Ähnlichkeit mit der 5' terminalen Region der Klone G+E+A von MSRV-1 aufweist, wodurch man die C-terminale Region des gag-Gens und eine neue Region, die der N-terminalen Region des MSRV-1-gag-Gens entspricht, definieren kann.

Mit CL2 kann man eine 1511 Bp große Region definieren, die ein offenes Leseraster in der 1077 Bp großen N-terminalen Region, die für 359 Aminosäuren codiert, sowie ein 454 Bp großes geschlossenes Leseraster, das der C-terminalen Region des MSRV-1-gag-Gens entspricht, darstellt.

Die Nukleotidsequenz von CL2 trägt die Bezeichnung SEQ ID NO: 130. Sie ist in 6 mit den potentiellen Leserastern in Aminosäuren dargestellt.

Das 1077 Bp große Fragment von CL2, das für 359 Aminosäuren codiert, wurde mittels PCR mit dem Enzym Pwo (5U/&mgr;l) (Boehringer Mannheim, Frankreich) unter Verwendung von 1 &mgr;l der DNA-Minipräparation des Klons 2 amplifiziert und zwar unter den folgenden Bedingungen: 1 Minute bei 95°C, 1 Minute bei 60°C, 2 Minuten bei 72°C über 25 Zyklen, mit einem Reaktionsendvolumen von 50 &mgr;l, mit Hilfe der Primer:

  • – 5'-Primer (BamHI), mit der Bezeichnung SEQ ID NO: 132

    5' TGC TGG AAT TCG GGA TCC TAG AAC GTA TTC 3' (30-mer), und
  • – 3'-Primer (Hind III), mit der Bezeichnung SEQ ID NO: 133

    5 AGT TCT GCT CCG AAG CTT AGG CAG ACT TTT 3' (30-mer),
die der Nukleotidsequenz von Klon 2 in Position –9 bis 21 bzw. 1066 bis 1095 entsprechen.

Das nach PCR erhaltene Fragment wurde mit Bam HI und HindIII linearisiert und in die Expressionsvektoren pET28C und pET21C (NOVAGEN), die mittels Bam HI und Hind III linearisiert worden waren, subkloniert. Die DNA des 1077 Bp großen Fragments von Klon 2 in den beiden Expressionsvektoren wurde nach dem für die Verwendung des "PRISMTM Ready Reaction Amplitaq® FS, DyeDeoxyTM Terminator" (Applied Biosystems, Nr. 402119) Sequenzierungskits empfohlenen Verfahren sequenziert, und die automatische Sequenzierung wurde mit den Geräten 373 A und 377 Applied Biosystems nach den Anwendungen des Herstellers durchgeführt.

Die Expression der Nukleotidsequenz des 1077 Bp großen Fragments von Klon 2 durch die Expressionsvektoren pET28C und pET21C tragen die Bezeichnung SEQ ID NO: 135 bzw. SEQ ID NO: 137.

Beispiel 6: EXPRESSION DES KLONS 2 BEI ESCHERICHIA COLI

Die Konstrukte pET28c-Klon 2 (1077 Bp) und pET21C-Klon 2 (1077 Bp) synthetisieren in dem Bakterienstamm BL21 (DE3) ein im Fall des Vektors pET28C in N- und C-terminaler Fusion und im Fall des Vektors pET21C in C-terminaler Fusion vorliegendes Protein mit 6 Histidinen mit einem scheinbaren Molekulargewicht von ungefähr 45 kDa, was durch Elektrophorese an Polyacrylamidgel SDS-PAGE (SDS = Sodium Dodecyl Sulphate) nachgewiesen wird (Laemmli, 1970 (1)). Die Reaktivität der Proteine gegenüber einem monoklonalen Antikörper gegen Histidine (DIANOVA) wurde mit der Western-Blot-Technik nachgewiesen (Towbin et al., 1979 (2)).

Die rekombinanten Proteine pET28c-Klon 2 (1077 Bp) und pET21C-Klon 2 (1077 Bp) wurden mit SDS-PAGE in der unlöslichen Fraktion nach enzymatischer Verdauung der Bakterienextrakte mit 50 &mgr;l Lysozym (10 mg/ml) und Ultraschall-Lyse sichtbar gemacht.

Die antigenen Eigenschaften der rekombinanten Antigene pET28C-Klon 2 (1077 Bp) und pET21C-Klon 2 (1077 Bp) wurden nach Solubilisierung des Bakterienpellets mit 2% SDS und 50 mM &bgr;-Mercaptoethanol mittels Western-Blot () getestet. Nach Inkubation mit Seren von Patienten, die an multipler Sklerose leiden, Seren von Neurologie-Kontrollen und Blutbank (BB)-Kontrollseren wurden die Immunkomplexe mit Hilfe eines mit alkalischer Phosphatase gekoppelten Anti-Human-IgG und Anti-Human-IgM-Ziegenserums nachgewiesen.

Die Ergebnisse sind in der folgenden Tabelle dargestellt.

TABELLE Reaktivität von multiple-Sklerose-Seren und Kontrollseren mit dem rekombinanten Protein MSRV-1 gag Klon 2 (1077 Bp) = pET21C-Klon 2 (1077 Bp) und pET28C-Klon 2 (1077 Bp)a
  • (a) Die Bahnen, die 1,5 &mgr;g an rekombinantem Antigen pET-gag Klon 2 (1077 Bp) enthalten, weisen eine Reaktivität mit 1/100-verdünnten Seren auf. Die Western-Blot-Interpretation beruht auf dem Vorhandensein bzw. Fehlen einer spezifischen pET-gag Klon 2 – Bande (1077 Bp) auf den Bahnen. In jedem Versuch werden Positiv- und Negativkontrollen mitgeführt.

Diese Ergebnisse zeigen daß unter den verwendeten Versuchsbedingungen ungefähr 40% der getesteten Multiple-Sklerose-Humanseren mit den rekombinanten Proteinen pET28C-Klon 2 (1077 Bp) und pET21C-Klon 2 (1077 Bp) reagieren. An einer Neurologie-Kontrolle wurde eine Reaktivität beobachtet, und es ist interessant, festzustellen, daß die aus diesem Serum erhaltenen RNA-Extrakte nach einem Reverse-Transkriptase-Schritt ebenfalls mittels PCR in der pol-Region amplifiziert werden. Dies legt nahe, daß Probanden, die angegeben haben, nicht unter MS zu leiden, dieses Virus ebenfalls bergen und exprimieren können. Im Gegensatz dazu weist eine scheinbar gesunde Kontrolle (Blutspender) Anti-gag-Antikörper (Klon 2, 1077 Bp) auf, was mit einer erworbenen Immunität gegen MSRV-1 neben einer angegebenen assoziierten Autoimmunkrankheit vereinbar ist.

Beispiel 7: GEWINNUNG EINES KLONS LB13, DER IN 3' EINEN ABSCHNITT MIT HOMOLOGIE ZU KLON 2, DER DEM GAG-GEN ENTSPRICHT, UND IN 5' EINEN ABSCHNITT MIT HOMOLOGIE ZU DEM KLON 5M6, DER DER U5-LTR-REGION ENTSPRICHT, ENTHÄLT

Mit Gesamt-RNA, die von Virionen aus mittels Ultrazentrifugationen konzentrierten Überständen von B-Lymphozyten-Zellen von MS-Patienten stammte, wurde eine RT-PCR ("reverse transkriptase polymerase chain reaction") durchgeführt. Die cDNA-Synthese wurde mit einem spezifischen Primer SEQ No. XXX und der reversen Transkriptase "ExpandTM RT" von BOEHRINGER MANNHEIM unter den von der Firma empfohlenen Bedingungen durchgeführt.

Für die Synthese der cDNA verwendeter Primer mit der Bezeichnung SEQ ID NO: 138:

5' CTT GGA GGG TGC ATA ACC AGG GAA T 3'

Eine PCR-Amplifikation wurde mit Taq-Polymerase (Perkin Elmer, Frankreich) unter den folgenden Bedingungen durchgeführt: 1 Minute bei 94°C, 1 Minute bei 55°C, 2 Minuten bei 72°C über 35 Zyklen und 7 Minuten bei 72°C mit einem Reaktionsendvolumen von 100 &mgr;l.

Für die PCR-Amplifikation verwendete Primer:

  • – 5'-Primer mit der Bezeichnung SEQ ID NO: 139

    5' TGT CCG CTG TGC TCC TGA TC 3'
  • – 3'-Primer mit der Bezeichnung SEQ ID NO: 138

    5' CTT GGA GGG TGC ATA ACC AGG GAA T 3'

Eine zweite mittels sogenannter "semi-nested" PCR Amplifikation wurde mit einem 3' Primer, der sich im Inneren der bereits amplifizierten Region befand, durchgeführt. Diese zweite Amplifikation wurde unter den gleichen Versuchsbedingungen wie denen, die bei der ersten Amplifikation angewandt wurden, durchgeführt, wobei 10 &mgr;l des Amplifikationsprodukt aus der ersten PCR verwendet wurden.

Für die Amplifikation mittels "semi-nested" PCR verwendete Primer:

  • – 5'-Primer mit der Bezeichnung SEQ ID NO: 139

    5' TGT CCG CTG TGC TCC TGA TC 3'
  • – 3'-Primer mit der Bezeichnung SEQ ID NO: 140

    5' CTA TGT CCT TTT GGA CTG TTT GGG T 3'

Die Primer SEQ ID NO: 138 und SEQ ID NO: 140 sind für die gag-Region von Klon 2, Nukleotidposition Nr. 373–397 und Nr. 433–456 spezifisch. Die in der 5'-Region verwendeten Primer wurden auf Sequenzen von in Vorversuchen erhaltenen Klonen definiert.

Ein 764 Bp großes Amplifikationsprodukt wurde folgendermaßen erhalten und kloniert:

Die amplifizierte DNA wurde mit Hilfe des "TA Cloning®"-Kits in ein Plasmid insertiert. Die 2 &mgr;l DNA-Lösung wurden mit 5 &mgr;l sterilem destilliertem Wasser, 1 &mgr;l eines 10fach konzentrierten Ligationspuffers mit der Bezeichnung "10X LIGATION BUFFER", 2 &mgr;l "pCRTM VECTOR" (25 ng/ml) sowie 1 &mgr;l "T4 DNA LIGASE" vermischt. Diese Mischung wurde 1 Nacht bei 14°C inkubiert. Die folgenden Schritte wurden entsprechend den Anweisungen des "TA Cloning®"-Kits (Invitrogen) durchgeführt. Nach Transformation der Ligation in E. coli INV&agr;F'-Bakterien wurde die Mischung ausgestrichen. Am Ende des Vorgangs wurden die weißen Kolonien der rekombinanten Bakterien vereinzelt und anschließend kultiviert und damit eine Extraktion der aufgenommenen Plasmide nach dem sogenannten "DNA-Minipräparation"(17)-Verfahren durchgeführt. Das Plasmidpräparat von jeder rekombinanten Kolonie wurde mit dem Restriktionsenzym Eco RI geschnitten und auf Agarosegel analysiert. Die Plasmide mit einem Insert, das nach Markierung des Gels mit Ethidiumbromid unter UV-Licht nachgewiesen wurde, wurden nach Hybridisierung mit einem komplementären Primer des auf dem Klonierungsplasmid des "TA Cloning®"-Kits vorhandenen T7-Promoters auf die Sequenzierung des Inserts selektiert. Die Reaktion vor der Sequenzierung wurde dann nach dem empfohlenen Verfahren für die Verwendung des Sequenzierkits "PRISMTM Ready Reaction Amplitaq® FS, DyeDeoxyTM Terminator" (Applied Biosystems, ref. 402119) durchgeführt, und die automatische Sequenzierung wurde gemäß den Anweisungen des Herstellers an den Geräten 373 A und 377 Applied Biosystems durchgeführt.

Der erhaltene Klon LB13 enthält eine N-terminale Region des MSRV-1-gag-Gens, das zu Klon 2 homolog ist, und einen LTR, der einem Teil der U5-Region entspricht. Zwischen der U5- und gag-Region wurde eine Anlagerungsstelle für die Transfer-RNAs, nämlich die PBS "primer binding site", identifiziert.

Die Nukleotidsequenz des 764 Bp großen Fragments des Klons LB13 in dem Plasmid "pCRTM Vektor" ist unter der Bezeichnung SEQ ID NO: 141 dargestellt.

Die Transfer-RNA-Anlagerungsstelle, die eine Sequenz des Tryptophan-PBS-Typs aufweist, wurde in Nukleotidpositon Nr. 342–359 des Klons LB13 identifiziert.

Da sich diese PBS auch in endogenen Kopien mit Homologie zu MSRV1 findet, wird die so definierte endogene Familie in Zukunft gemäß der für die Familie der endogenen Retroviren vorgeschlagenen Nomenklatur HERV W genannt (W=Tryptophan).

Ein kurzes, ungefähr 65 Aminosäuren langes ORF wurde auch in der U5-Region des 5'-LTR von Klon LB13 gefunden.

Sequenz des ORF:

PMASNRAITLTAWSKIPFLGIRETKNPRSENTRLATMLEAAHHHFGSSPPLSWEL WEQGPQVTIW.

Die entsprechende Nukleotidsequenz, die mit einem ATG-Codon beginnt, kann in einer subgenomischen DNA von einem proviralen LTR (U3RU5) ausgehend exprimiert werden.

Ein anderer, LA15 genannter Klon wurde von aus mittels Ultrazentrifugation von einem Kulturüberstand von Synoviozyten eines Patienten mit rheumatoider Polyarthritis konzentrierten Virionen extrahierter Gesamt-DNA erhalten. Die Amplifikationsstrategie und Klonierung des Klons LA 15 ist genauso, wie sie für den Klon LB13 beschrieben wurde.

Die Nukleotidsequenz des Klons LA15 ist unter der Bezeichnung SEQ ID NO: 142 dargestellt und weist eine starke Ähnlichkeit mit dem Klon LB13 auf. Dies legt nahe, daß das bei multipler Sklerose nachgewiesene Retrovirus MSVR-1 Sequenzen mit Ähnlichkeit zu jenen, die auch bei der rheumatoiden Polyarthritis gefunden werden, aufweist.

BEISPIEL 8: REKONSTRUKTION EINER RU5-GAG A REGION AUSGEHEND VON DEN KLONEN LB15, LB13, CL2 UND CL17

Die Klone CL2 und LB13 sind bereits in den vorhergehenden Beispielen beschrieben worden. Der Klon LB15 wurde unter Verwendung der Sequenz R des LTR von Klon c16 verwendet, um einen 5'-Primer zu definieren, und die verwendeten Antisense-Primer sind die gleichen wie bei Klon LB13. Klon CL17 wurde durch "nested" RT-PCR unter Verwendung der folgenden Primer erhalten:

5'-TCATGCAACTGCACTCTTCTGGTCCG-3' (sense)

5'-TCTTGCACTAACCTCCACTGTCCGTTGG-3' (antisense)

5'-ATCCCCCAGTAACAATTTGGTGACCACG-3' (sense)

5'-TCGGGTCTAAGAGGGTACTTCCTTTGGTAGG-3' (antisense)

Klon LB15 wurde von Virionen, die durch Kultur von MS-Zellen erhalten wurden, erhalten. Klon LB17 wurde aus einer Plasmakultur eines MS-Patienten erhalten.

Mit diesen überlappenden Klonen konnte man eine RU5-gag-Sequenz mit einem potentiellen ORF im gag-Gen, wie in 14 dargestellt, rekonstruieren.

BEISPIEL 9: GEWINNUNG EINES KLONS 87–23

Die der Integrase entsprechende Region wurde ausgehend von MS-Plasma unter Verwendung einer "semi-nested" RT-PCR mit den folgenden Primern, die sich in der pol- und der env-Region von MSRV1 befinden, amplifiziert und kloniert.

In der pol-Region:

5'-TTACGCAGGTCTCAGGGATGAGCTT-3' (primäre sense-PCR)

5'-CGGCAGTAGCAGTCTTAGTATCTGAAGCAGTTA-3' (sekundäre sense-PCR)

In der env-Region

5'-GGTACGGAGGGTTTCATGTAGTTTTGAG-3' (primäre und sekundäre antisense-PCR)

Der amplifizierte Klon umfaßt 774 Bp in der pol/RT-Region, die gesamte Integrase-Region (1197 Bp) und den Beginn der env-Region (480 Bp). Die der Integraseregion entsprechende Nukleotidsequenz und die Translation in Aminosäuren des potentiellen ORF sind in 15 dargestellt.

BEISPIEL 10: BESTÄTIGUNG DES VORLIEGENS VON RNA, DIE ENV-SEQUENZEN MIT ÄHNLICHKEIT ZU ERV9 ENTHÄLT, IN MIT DEM MSRV1-GENOM ASSOZIIERTEN RETROVIRUSPARTIKELN:

Sequenzen mit Ähnlichkeit zu ERV9 wurden im Vergleich zu den MSRV1-Sequenzen in kleinen Mengen in den Präparaten des Virions von MS gefunden. Das Phänomen der Mitverkapselung von phylogenetisch nahen endogenen Sequenzen in von einem replizierenden Stamm produzierten Retroviruspartikeln ist beschrieben worden. Überraschenderweise wurde eine RNA-Region, die ein ORF, das im 3'-Abschnitt von env begann und sich möglicherweise in das 3'-LTR weitererstreckte, umfaßte, in verschiedenen MS-Proben gefunden. Um das Vorhandensein eines ORF anzugeben, wurden Transkriptions-Translations-Versuche durchgeführt, mit denen das tatsächliche Vorliegen eines env-ORF, der den gesamten Transmembranteil (TM) enthielt und am Anfang des putativen LTR aufhörte, gezeigt werden konnte. Dennoch folgt ein zusätzliches Raster (ORFX), das sich in das 3'-LTR fortsetzt. Die beiden Expressionsprodukte wurden sichtbar gemacht und ihre entsprechenden ORFs wurden subkloniert. 16 zeigt die Nukleotid- und Peptidsequenzen von Klon B13, der bereits beschrieben wurde, unter Angabe der ORFs in der verkürzten env-Region und in dem putativen LTR. Das Vorhandensein von solchen RNA kann die Ursache von Rekombinationen mit dem replizierenden Stamm sein und so zu Stämmen mit modifizierter Pathogenität führen.

LITERATURANGABEN
  • (1) Laemmli U.K. Cleavage of structural proteins during the assembly of the head of bacteriophage T4. Nature. (1970). 227: 680–685.
  • (2) Towbin H., Staehelin T. & Gordon J. Electrophoretic transfer of proteins from polyacrylamide gels to nitrocellulose sheets: procedure and some applications. Proc. Natl. Acad. Sci. USA. (1979). 76: 4350–4354.
SEQUENZPROTOKOLL

Anspruch[de]
  1. Nukleinsäuren in isolierter oder aufgereinigter Form, die eine Nukleotidsequenz aus der Gruppe (i) der Sequenzen SEQ ID NO: 114, SEQ ID NO: 117, SEQ ID NO: 120; (ii) der zu den Sequenzen (i) komplementären Sequenzen; sowie (iii) der zu den Sequenzen (i) oder (ii) äquivalenten Sequenzen, die über eine beliebige Reihe von 100 aufeinanderfolgenden Monomeren mindestens 50% Homologie mit den Sequenzen (i) bzw. (ii) aufweisen, umfassen, wobei sich die Nukleinsäuren von der Sequenz HSAC64 des menschlichen Klons RG083M05, der unter der Nummer AC000064 bei der EMBL-Datenbank verfügbar ist, unterscheiden.
  2. Nukleinsäuren nach Anspruch 1, dadurch gekennzeichnet, daß sie eine Nukleotidsequenz aus der Gruppe (iii) der zu den Sequenzen (i) oder (ii) äquivalenten Sequenzen, die über eine beliebige Reihe von 100 aufeinanderfolgenden Monomeren mindestens 70% Homologie mit den Sequenzen (i) bzw. (ii) aufweisen, umfassen.
  3. Nukleinsäuren im isolierten oder aufgereinigten Zustand, die für ein Polypeptid codieren, das über eine beliebige aufeinanderfolgende Reihe von mindestens 30 Aminosäuren mindestens 50% Homologie mit einer Peptidsequenz aus der Gruppe SEQ ID NO: 115, SEQ ID NO: 118, SEQ ID NO: 121 aufweist, wobei sich die Nukleinsäuren von der Sequenz HSAC64 des menschlichen Klons RG083M05, der unter der Nummer AC000064 bei der EMBL-Datenbank verfügbar ist, unterscheiden.
  4. Nukleinsäuren nach Anspruch 3, dadurch gekennzeichnet, daß sie für ein Polypeptid codieren, das über eine beliebige aufeinanderfolgende Reihe von mindestens 30 Aminosäuren mindestens 70% Homologie mit einer Peptidsequenz aus der Gruppe SEQ ID NO: 115, SEQ ID NO: 118, SEQ ID NO: 121 aufweist.
  5. Retrovirale Nukleinsäuren, bei denen das env-Gen eine Nukleotidsequenz aus der Gruppe SEQ ID NO: 114, SEQ ID NO: 117 und SEQ ID NO: 120 sowie ihre komplimentären Sequenzen umfaßt.
  6. Retrovirale Nukleinsäuren, bei denen das env-Gen eine Nukleotidsequenz, die bei Nukleotid 1 der SEQ ID NO: 117 beginnt und bei Nukleotid 233 der SEQ ID NO: 114 aufhört, umfaßt.
  7. Retrovirale Nukleinsäuren, bei denen das env-Gen für ein Polypeptid codiert, das über eine beliebige aufeinanderfolgende Reihe von mindestens 30 Aminosäuren mindestens 50% Homologie mit der SEQ ID NO: 118 aufweist.
  8. Nukleinsäuren nach Anspruch 7, dadurch gekennzeichnet, daß ihr env-Gen für ein Polypeptid codiert, das über eine beliebige aufeinanderfolgende Reihe von mindestens 30 Aminosäuren mindestens 70% Homologie mit der SEQ ID NO: 118 aufweist.
  9. Retrovirale Nukleinsäuren, deren U3R-Region des 3'-LTR eine Nukleotidsequenz, die bei Nukleotid 617 von SEQ ID NO: 114 aufhört, umfaßt.
  10. Retrovirale Nukleinsäuren, deren RU5-Region des 5'-LTR eine Nukleotidsequenz, die bei Nukleotid 755 von SEQ ID NO: 120 beginnt, umfaßt.
  11. Retrovirale Nukleinsäuren, die eine Sequenz, die bei Nukleotid 755 von SEQ ID NO: 120 beginnt und bei Nukleotid 617 von SEQ ID NO: 114 aufhört, umfassen.
  12. Retrovirale Nukleinsäuren nach einem der vorhergehenden Ansprüche, dadurch gekennzeichnet, daß sie mit mindestens einer Autoimmunerkrankung aus der Gruppe multiple Sklerose und rheumatoide Polyarthritis assoziiert sind.
  13. Nukleotidfragment, das eine Nukleotidsequenz aus der Gruppe (i) der Sequenzen SEQ ID NO: 114, SEQ ID NO: 117, SEQ ID NO: 120; (ii) der zu den Sequenzen (i) komplementären Sequenzen; sowie (iii) der zu den Sequenzen (i) oder (ii) äquivalenten Sequenzen, die über eine beliebige Reihe von 100 aufeinanderfolgenden Monomeren mindestens 50% Homologie mit den Sequenzen (i) bzw. (ii) aufweisen, umfaßt, wobei sich das Nukleotidfragment von der Sequenz HSAC64 des menschlichen Klons RG083M05, der unter der Nummer AC000064 bei der EMBL-Datenbank verfügbar ist, unterscheidet.
  14. Nukleotidfragment nach Anspruch 13, dadurch gekennzeichnet, daß es eine Nukleotidsequenz aus der Gruppe (iii) der zu den Sequenzen (i) oder (ii) äquivalenten Sequenzen, die über eine beliebige Reihe von 100 aufeinanderfolgenden Monomeren mindestens 70% Homologie mit den Sequenzen (i) bzw. (ii) aufweisen, umfaßt.
  15. Nukleotidfragment nach Anspruch 13, das aus einer Nukleotidsequenz aus der Gruppe (i) der Sequenzen SEQ ID NO: 114, SEQ ID NO: 117, SEQ ID NO: 120; (ii) der zu den Sequenzen (i) komplementären Sequenzen; sowie (iii) der zu den Sequenzen (i) oder (ii) äquivalenten Sequenzen, die über eine beliebige Reihe von 100 aufeinanderfolgenden Monomeren mindestens 50% Homologie mit den Sequenzen (i) bzw. (ii) aufweisen, besteht.
  16. Nukleotidfragment nach Anspruch 15, dadurch gekennzeichnet, daß es aus einer Nukleotidsequenz aus der Gruppe (iii) der zu den Sequenzen (i) oder (ii) äquivalenten Sequenzen, die über eine beliebige Reihe von 100 aufeinanderfolgenden Monomeren mindestens 70% Homologie mit den Sequenzen (i) bzw. (ii) aufweisen, besteht.
  17. Nukleotidfragment, das eine Nukleotidsequenz umfaßt, die für ein Polypeptid codiert, das über eine beliebige aufeinanderfolgende Reihe von mindestens 30 Aminosäuren mindestens 50% Homologie mit einer Peptidsequenz aus der Gruppe SEQ ID NO: 115, SEQ ID NO: 118, SEQ ID NO: 121 aufweist, wobei sich das Nukleotidfragment von der Sequenz HSAC64 des menschlichen Klons RG083M05, der unter der Nummer AC000064 bei der EMBL-Datenbank verfügbar ist, unterscheidet.
  18. Nukleotidfragment nach Anspruch 17, dadurch gekennzeichnet, daß es für ein Polypeptid codiert, das über eine beliebige aufeinanderfolgende Reihe von mindestens 30 Aminosäuren mindestens 70% Homologie mit einer Peptidsequenz aus der Gruppe SEQ ID NO: 115, SEQ ID NO: 118, SEQ ID NO: 121 aufweist.
  19. Nukleotidfragment nach Anspruch 17, das aus einer Nukleotidsequenz besteht, die für ein Polypeptid codiert, das über eine beliebige aufeinanderfolgende Reihe von mindestens 30 Aminosäuren mindestens 50% Homologie mit einer Peptidsequenz aus der Gruppe SEQ ID NO: 115, SEQ ID NO: 118 und SEQ ID NO: 121 aufweist.
  20. Nukleotidfragment nach Anspruch 19, dadurch gekennzeichnet, daß es aus einer Nukleotidsequenz besteht, die für ein Polypeptid codiert, das über eine beliebige aufeinanderfolgende Reihe von mindestens 30 Aminosäuren mindestens 70% Homologie mit einer Peptidsequenz aus der Gruppe SEQ ID NO: 115, SEQ ID NO: 118, SEQ ID NO: 121 aufweist.
  21. Gensonde für den Nachweis eines mit multipler Sklerose und/oder rheumatoider Polyarthritis assoziierten Retrovirus, dadurch gekennzeichnet, daß sie spezifisch mit einem beliebigen Fragment nach einem der Ansprüche 13 bis 20, das zu dem Genom dieses Retrovirus gehört, hybridisieren kann und daß sie 10 bis 100 Nukleotide aufweist.
  22. Sonde nach Anspruch 21, dadurch gekennzeichnet, daß sie 10 bis 30 Nukleotide aufweist.
  23. Primer für die Amplifikation einer RNA oder einer DNA eines mit multipler Sklerose und/oder rheumatoider Polyarthritis assoziierten Retrovirus mittels Polymerisation, dadurch gekennzeichnet, daß er eine Nukleotidsequenz umfaßt, die zu mindestens einem Teil der Nukleotidsequenz eines Fragments nach einem der Ansprüche 13 bis 20, wobei dieses Nukleotidfragment zu dem env-Gen dieses Retrovirus gehört, identisch ist, und dadurch, daß dieser Teil dieser Nukleotidsequenz mindestens 6 Monomere umfaßt.
  24. Primer nach Anspruch 23, dadurch gekennzeichnet, daß er 10 bis 30 Monomere umfaßt.
  25. Primer für die Amplifikation einer RNA oder einer DNA eines mit multipler Sklerose und/oder rheumatoider Polyarthritis assoziierten Retrovirus mittels Polymerisation, dadurch gekennzeichnet, daß er eine Nukleotidsequenz umfaßt, die über eine beliebige Reihe von 10 aufeinanderfolgenden Monomeren mindestens 50% Homologie mit einem Fragment nach einem der Ansprüche 13 bis 20, wobei dieses Nukleotidfragment zu dem env-Gen dieses Retrovirus gehört, aufweist, und dadurch, daß diese Nukleotidsequenz 10 bis 30 Monomere umfaßt.
  26. Primer nach Anspruch 25, dadurch gekennzeichnet, daß er eine Nukleotidsequenz, die über eine beliebige Reihe von 10 aufeinanderfolgenden Monomeren mindestens 70% Homologie mit diesem Fragment aufweist, umfaßt.
  27. Primer nach Anspruch 24, dadurch gekennzeichnet, daß seine Nukleotidsequenz aus der Gruppe SEQ ID NO: 116 und SEQ ID NO: 119 stammt.
  28. Replikations- und/oder Expressionsvektor, der ein Nukleotidfragment nach einem der Ansprüche 13 bis 20 umfaßt.
  29. Peptid, das von einem beliebigen offenen Leseraster, das zu einem Nukleotidfragment nach einem der Ansprüche 13 bis 20 gehört, codiert wird.
  30. Peptid, das eine Peptidsequenz umfaßt, die mit einer Sequenz aus der Gruppe SEQ ID NO: 115, SEQ ID NO: 118 und SEQ ID NO: 121 stammt, identisch ist.
  31. Peptid, das eine Peptidsequenz umfaßt, die über eine beliebige aufeinanderfolgende Reihe von mindestens 30 Aminosäuren mindestens 50% Homologie mit einer Sequenz aus der Gruppe SEQ ID NO: 115, SEQ ID NO: 118 und SEQ ID NO: 121 aufweist.
  32. Peptid nach Anspruch 31, dadurch gekennzeichnet, daß es eine Peptidsequenz aufweist, die über eine beliebige aufeinanderfolgende Reihe von mindestens 30 Aminosäuren mindestens 70% Homologie mit einer Sequenz aus der Gruppe SEQ ID NO: 115, SEQ ID NO: 118 und SEQ ID NO: 121 aufweist.
  33. Diagnostische, prophylaktische oder therapeutische Zusammensetzung, die ein Nukleotidfragment nach einem der Ansprüche 13 bis 20 umfaßt.
  34. Verfahren für den Nachweis eines mit multipler Sklerose und/oder rheumatoider Polyarthritis assoziierten Retrovirus in einer biologischen Probe, dadurch gekennzeichnet, daß man eine RNA und/oder eine DNA, von der angenommen wird, daß sie zu diesem Retrovirus gehört oder davon stammt, oder deren komplementäre RNA bzw. DNA mit einer Zusammensetzung, die ein Nukleotidfragment nach einem der Ansprüche 13 bis 20 umfaßt, in Kontakt bringt.
Es folgen 32 Blatt Zeichnungen






IPC
A Täglicher Lebensbedarf
B Arbeitsverfahren; Transportieren
C Chemie; Hüttenwesen
D Textilien; Papier
E Bauwesen; Erdbohren; Bergbau
F Maschinenbau; Beleuchtung; Heizung; Waffen; Sprengen
G Physik
H Elektrotechnik

Anmelder
Datum

Patentrecherche

Patent Zeichnungen (PDF)

Copyright © 2008 Patent-De Alle Rechte vorbehalten. eMail: info@patent-de.com