PatentDe  


Dokumentenidentifikation DE69534856T2 21.09.2006
EP-Veröffentlichungsnummer 0000871891
Titel MESSUNG DER GESCHWINDIGKEIT BIOMOLEKULARER REAKTIONEN MITTELS ELEKTROCHEMOLUMINESZENZ
Anmelder Bioveris Corp., Gaithersburg, Md., US
Erfinder NACAMULLI, Laurette, Rockville, Maryland 20852, US;
LELAND, K., Jonathan, Silver Spring, Maryland 20905, US;
JAMEISON, A., Stephanie, Montgormery Village, Maryland 20886, US
Vertreter Schwabe, Sandmair, Marx, 81677 München
DE-Aktenzeichen 69534856
Vertragsstaaten AT, BE, CH, DE, DK, ES, FR, GB, GR, IE, IT, LI, LU, MC, NL, PT, SE
Sprache des Dokument EN
EP-Anmeldetag 04.12.1995
EP-Aktenzeichen 959440751
WO-Anmeldetag 04.12.1995
PCT-Aktenzeichen PCT/US95/15982
WO-Veröffentlichungsnummer 1996017248
WO-Veröffentlichungsdatum 06.06.1996
EP-Offenlegungsdatum 21.10.1998
EP date of grant 08.03.2006
Veröffentlichungstag im Patentblatt 21.09.2006
IPC-Hauptklasse G01N 33/557(2006.01)A, F, I, 20051017, B, H, EP
IPC-Nebenklasse C12Q 1/00(2006.01)A, L, I, 20051017, B, H, EP   G01N 33/58(2006.01)A, L, I, 20051017, B, H, EP   

Beschreibung[de]
HINTERGRUND DER ERFINDUNG Gebiet der Erfindung

Die vorliegende Erfindung betrifft analytische Verfahren und Systeme zur Messung der Geschwindigkeit von biomolekularen Reaktionen. Genauer hat die Erfindung mit der Verwendung von Elektrochemilumineszenz („ECL") zur Überwachung des Fortschreitens einer biomolekularen Reaktion in Realzeit zu tun. Das Verfahren kann zur Überwachung des Fortschreitens von Affinitätbindungsreaktionen verwendet werden und als solches kann es unter anderen bei Antikörper-Antigen-Bindungsgeschwindigkeitsmessungen verwendet werden. Das Verfahren kann auch für die diagnostische Bestimmung einer Enzymaktivität oder -konzentration und für andere Geschwindigkeitsmessungen verwendet werden, wie für den Fachmann ersichtlich sein wird.

Beschreibung des Standes der Technik

Es gibt verschiedene bekannte Verfahren zum Messen des Fortschreitens von biomolekularen Reaktionen und die vorliegende Erfindung stellt ein neues Verfahren zum Überwachen der Geschwindigkeiten von solchen Reaktionen bereit. Das Fortschreiten von enzymatischen Reaktionen wurde zum Beispiel durch Spektrophotometrie und Fluoreszenz überwacht. Diese Verfahren und andere werden in modernen Laboratorien verwendet und wurden von den Anmeldern verwendet, um Referenzdaten für die Entwicklung der neuen analytischen Technik der vorliegenden Erfindung zu erhalten.

Antigen-Antikörper-Reaktionsgeschwindigkeiten können unter Verwendung einer Technologie gemessen werden, die biospezifische Wechselwirkungsrealzeitanalyse genannt wird und Oberflächenplasmonresonanz zur Detektion von biomolekularen Wechselwirkungen verwendet. In einem Artikel mit dem Titel „Label-Free Biosensor Technology Visualizes Biomolecular Interactions in Real Time", Biosensors & Bioelectronics, Bd. 8, Nr. 2, Products and Innovations, S. xi–xiv wurde berichtet, dass das Verfahren eine wertvolle Ergänzung zu herkömmlichen Untersuchungsverfahren ist. Die Verwendung von Oberflächenplasmonresonanz wird auch von Sjolander, S. und Urbaniczky, C. in „Integrated Fluid Handling System for Biomolecular Interaction Analysis", Analytical Chemistry 1991, Bd. 63, S. 2338–2345 erörtert. Gemäß dem Verfahren kann man den Kinetiken von biomolekularen Wechselwirkungen zwischen einem Antigen und einem Antikörper direkt ohne Markieren folgen. Das Verfahren ist zur Detektion in situ von niedrigen Konzentrationen von biochemisch aktiven Molekülen mit hohem Molekulargewicht nützlich.

Von einem allgemeinen Verfahren zur Bestimmung der Dissoziationskonstante (KD) der Antigen-Antikörper-Gleichgewichte in Lösung wird von Friguet, B., et al., in „Measurements of the True Affinity Constant in Solution of Antigen-Antibody Complexes by Enzyme-Linked Immunosorbent Assay", Journal of Immunological Methods 1985, Bd. 77, S. 305–319 berichtet. Das Verfahren verwendet einen klassischen indirekten ELISA und es wird berichtet, dass es die Detektion von sehr kleinen Konzentrationen von Antikörper und die Bestimmung von KD-Werten von nur 10–9 M erlaubt.

Das Verfahren und System der vorliegenden Erfindung verwendet Elektrochemilumineszenz, die bisher in analytischen Verfahren zur qualitativen und quantitativen Analyse von chemischen Einheiten verwendet wurde. Im US Patent Nr. 5,310,687 wird zum Beispiel eine chemische Einheit offenbart, die eine chemische, biochemische oder biologische Substanz umfasst, welche an eine oder mehrere elektrochemilumineszente organometallische Verbindungen gebunden ist. Es werden Verfahren zur Detektion von niedrigen Konzentrationen der chemischen Einheit unter Verwendung von chemilumineszenten, elektrochemilumineszenten und photolumineszenten Mitteln offenbart. Es werden Verbindungen offenbart, die zum Markieren von Substanzen von Interesse mit Ruthenium-enthaltenden und Osmium-enthaltenden Markierungen oder anderen elektrochemilumineszenten Markierungen nützlich sind. Die markierten Substanzen sind in Verfahren zum Detektieren und Quantifizieren von Analyten von Interesse in Bindungstests und kompetitiven Bindungstests nützlich.

Wir haben nun ein Verfahren und System der Verwendung von Elektrochemilumineszenz zur Überwachung des Fortschreitens von biomolekularen Reaktionen entdeckt und das Verfahren kann in diagnostischen Kits für klinische Verwendung, Forschungslaboratorien und dergleichen verwendet werden. Das Verfahren verwendet kommerziell erhältliche Ausrüstung und stellt ein sehr genaues Mittel für die diagnostische Bestimmung einer Enzymaktivität oder -konzentration bereit. Das Verfahren stellt auch ein Mittel zum Messen von Antikörper-Antigen-Bindungsgeschwindigkeiten bereit und es ist zur Durchmusterung (engl. screening) von Antikörpern mit hoher Bindungsgeschwindigkeit nützlich. In einer Ausführungsform wurde ein Verfahren zum Messen der Geschwindigkeiten der Antikörperbindung an ein Embryonenkarzinomantigen abgeleitet. In einer anderen Ausführungsform wurde ein Verfahren zur Bestimmung von Laktatdehydrogenase für klinische Verwendungen abgeleitet.

ZUSAMMENFASSUNG DER ERFINDUNG

Eine biomolekulare Reaktion, die gemäß der vorliegenden Erfindung überwacht werden soll, muss unter Verwendung eines Luminophors unter Reaktionsbedingungen durchgeführt werden, die die Konzentration eines Reaktanden oder eines Produkts der Reaktion mit der ECL-Intensität in Beziehung bringen. Die in der Reaktion verwendeten Reagenzien werden deshalb einen Reaktionspartner einschließen, der mit dem Reaktanden reagiert und mit dem Luminophor partizipiert, um die Emission von ECL zu verursachen. In einigen Ausführungsformen ist es das Reaktionsprodukt des Reaktionspartners, das mit dem Luminophor partizipiert, um die Emission von ECL zu verursachen. Das Verfahren der Erfindung erfordert auch die Modulierung und Messung der ECL-Intensität der biomolekularen Reaktion und die Demodulierung der Intensitätsmessung.

Gemäß der Erfindung wird ein Verfahren zur Durchführung einer Bestimmung des zeitlichen Verlaufes einer biomolekularen oder enzymatischen Reaktion in einer Zusammensetzung, enthaltend einen Luminophor, einen Reaktanden und einen Reaktionspartner, bereitgestellt, wobei das Verfahren die folgenden Schritte umfasst:

  • a) Exponieren der Zusammensetzung an eine Serie von Pulsen elektrischer Energie zu ausgewählten Zeitintervallen, wobei die Pulse von ausreichender Größe sind, um den Luminophor zur Emission eines Elektrochemilumineszenzsignals zu induzieren, wodurch eine Serie von Elektrochemilumineszenzsignalpeaks erzeugt wird, die den einzelnen Pulsen entsprechen;
  • b) Messen des Elektrochemilumineszenzsignals zu einer Vielzahl der gewählten Zeitintervalle;
  • c) Korrelieren des bei jedem der Vielzahl gewählter Zeitintervalle gemessenen Elektrochemilumeszenzsignals mit der jeweiligen Konzentration des Reaktanden, des Reaktionspartners, des Reaktionsprodukts oder von Kombinationen davon zu jedem der Vielzahl der gewählten Zeitintervalle, um den zeitlichen Verlauf der biomolekularen oder enzymatischen Reaktion zu bestimmen; und
  • d) Ausführen der Bestimmung auf Basis der Korrelation.

Die biomolekulare Reaktion wird in einer elektrochemischen Zelle durchgeführt und eine Serie von elektrischen Pulsen wird bei einem vorgewählten Potential und zu vorgewählten konstanten Zeitintervallen und konstanter Dauer zur Modulierung des ECL-Ausgangssignals verwendet. Die Intensität der resultierenden Lumineszenz wird zu den gleichen Intervallen gemessen, um eine zeitlich festgelegte Serie von Werten bereit zu stellen, die als fortschreitende Reaktion (P) bezeichnet wird. Der gleiche Versuch wird wiederholt, außer, dass das Erreichen des Abschlusses ermöglicht wird, bevor die ECL-Intensität durch Pulsen und Messen von Lumineszenz unter den gleichen Bedingungen gemessen wird, um eine zeitlich festgelegte Serie von Werten bereit zu stellen, die als abgeschlossene Reaktion (C) bezeichnet wird. Der gleiche Versuch wird ein drittes Mal in der Abwesenheit des Reaktionspartners wiederholt und die ECL-Intensität wird zu den gleichen Intervallen gemessen, um eine zeitlich festgelegte Serie von Werten bereit zu stellen, die als Kontrolle (Hintergrundreaktion) (B) bezeichnet wird.

Der zeitliche Verlauf, Konzentration gegen Zeit, der Reaktion wird durch Demodulierung der Intensitätsmessungen bestimmt. Dies wird durch Subtrahieren der Kontrolle (B) von der fortschreitenden Reaktion (P) und Teilen durch die Differenz der abgeschlossenen Reaktion (C) minus die Kontrolle (B) erreicht. Entsprechend wird die enzymatische Reaktion (P) durch die folgende Formel normalisiert (N):

Der zeitliche Verlauf wird mit einem bekannten Standard verglichen, um die Konzentration über die Zeit zu bestimmen, und die Reaktionsgeschwindigkeit kann zu jedem Zeitpunkt durch Verwenden der ersten Ableitung (Tangentensteigung) an diesem Punkt an der Konzentration-gegen-Zeit-Kurve bestimmt werden.

Das Enzymgeschwindigkeitsmessverfahren der Erfindung erfordert eine enzymatische Reaktion, die eine Substanz herstellt oder verbraucht, die ECL-aktiv ist. Wenn die Reaktion fortschreitet, wird die ECL-Intensität mit der Konzentration der ECL-aktiven Substanz variieren. Ein Luminophor und die ECL-aktive Substanz (oder die Substanz, die die ECL-aktive Substanz herstellt) werden mit den anderen Reaktanden gemischt. Das Enzym wird zuletzt zugegeben und man lässt die Reaktion in einer elektrochemischen Zelle ablaufen. Eine Serie von elektrischen Pulsen wird wie vorstehend erläutert verwendet und die ECL-Intensität wird gemessen und demoduliert, um den zeitlichen Verlauf der Reaktion zu erhalten. Bei der Messung von Bindungsreaktionsgeschwindigkeiten, zum Beispiel von Antikörper-Antigen-Bindungsgeschwindigkeiten, werden zwei Reagenzien vor dem Bindungsereignis hergestellt. Ein Luminophor, wie Ru(2,2'-bipyridin)32+ (der hier manchmal als „Ru(bpy)32+" abgekürzt wird und der Bipyridin-Ligand selbst wird hier manchmal als „bpy" abgekürzt), wird an den Antikörper, dessen Bindungsgeschwindigkeit bestimmt werden soll, gebunden und das Antigen (der Reaktionspartner) wird an ein Magnetkügelchen gebunden. Ein ORIGEN®-Analysegerät, das von Igen, Inc., 1530 East Jefferson Street, Rockville, MD 20852, U.S.A. erhältlich ist, kann verwendet werden, um Proben, die Magnetkügelchen enthalten, zu dispensieren und um die Analyse durchzuführen. Die Proben werden in die elektrochemische Fließzelle des Analysegeräts hineingezogen und die mit Antigen versehenen Magnetkügelchen werden einheitlich auf der Arbeitselektrode aus dem Fließstrom durch Platzieren eines Magneten direkt darunter aufgebracht. Das Bindungsereignis wird initiiert und schreitet fort durch kontinuierliches Ziehen von markiertem Antikörper durch die elektrochemische Fließzelle des Analysegeräts. Wenn das Bindungsereignis fortschreitet, bindet die ECL-aktive Markierung an das Magnetkügelchen. Eine Serie von elektrischen Pulsen wird wie vorstehend beschrieben verwendet. Ein Anstieg bei der ECL findet statt, wenn das Binden abläuft, und weist auf ein Fortschreiten der Reaktion hin. Die ECL-Intensität wird dann demoduliert, um den zeitlichen Verlauf der Reaktion zu erhalten.

Die elektrochemilumineszenten Markierungen, die gemäß der Erfindung verwendet werden, sind empfindlich, nicht gefährlich und nicht teuer und sie können bei einer großen Vielzahl von Verwendungen verwendet werden.

BESCHREIBUNG DER BEVORZUGTEN AUSFÜHRUNGSFORMEN

Der zeitliche Verlauf einer biomolekularen Reaktion wird gemäß der vorliegenden Erfindung durch Bilden einer ersten Reaktionsmischung, die einen Reaktanden, einen Luminophor und einen Reaktionspartner enthält, bestimmt. Der Reaktand reagiert mit dem Reaktionspartner und der Luminophor partizipiert mit dem Reaktionspartner, wobei Elektrochemilumineszenz durch Exposition der Reaktionsmischung an elektrische Energie emittiert wird. In einigen Ausführungsformen der Erfindung partizipiert das Reaktionsprodukt des Reaktionspartners, vielmehr als der Reaktionspartner selbst, mit dem Luminophor, um Elektrochemilumineszenz zu emittieren. Eine Serie von elektrischen Pulsen wird bei der ersten Reaktionsmischung bei einem vorgewählten Potential und zu vorgewählten Zeitintervallen und Dauer verwendet und die Elektrochemilumineszenz wird zu denselben Intervallen gemessen, um einen Wert für jedes Intervall zu erhalten.

Eine zweite Reaktionsmischung wird gebildet, die die gleiche ist, wie die erste Reaktionsmischung. Die Reagenzien der zweiten Reaktionsmischung lässt man bis zum Abschluss der Reaktion reagieren und dann wird die Mischung an eine Serie von elektrischen Pulsen beim gleichen Potential, Zeitintervallen und Dauer wie bei der ersten Reaktionsmischung exponiert. Die Elektrochemilumineszenz wird zu den gleichen Intervallen wie bei der ersten Reaktionsmischung gemessen, um für jedes Intervall einen Wert zu erhalten.

Die dritte Reaktionsmischung wird gebildet, die die gleiche ist, wie die erste Reaktionsmischung, außer, dass sie nicht den Reaktionspartner enthält. Eine Serie von elektrischen Pulsen wird bei der dritten Reaktionsmischung beim gleichen Potential, Zeitintervallen und Dauer wie bei der ersten Reaktionsmischung verwendet. Die Elektrochemilumineszenz wird zu den gleichen Intervallen wie bei der ersten Reaktionsmischung gemessen, um für jedes Intervall einen Wert zu erhalten.

Der Wert, der für das erste Intervall für die dritte Reaktionsmischung erhalten wurde, wird von dem Wert, der für das erste Intervall für die erste Reaktionsmischung erhalten wurde, subtrahiert, wobei eine erste Differenz erhalten wird. Der Wert, der für das erste Intervall für die dritte Reaktionsmischung erhalten wurde, wird auch von dem Wert, der für das erste Intervall für die zweite Reaktionsmischung erhalten wurde, subtrahiert, um eine zweite Differenz zu erhalten. Die erste Differenz wird durch die zweite Differenz geteilt, um einen normalisierten Wert für das erste Intervall zu erhalten. Der normalisierte Wert wird dann in gleichen Weise für jedes folgende Intervall berechnet, wobei eine Serie von normalisierten Werten erhalten wird, die aufgezeichnet werden kann, um den zeitlichen Verlauf (Konzentration gegen Zeit) graphisch zu veranschaulichen. Andere mathematische Operationen können mit den Daten durchgeführt werden, wie für den Fachmann ersichtlich sein wird. Zum Beispiel kann man die erste Ableitung an jedem Punkt an der normalisierten Wertekurve verwenden, um die Geschwindigkeit der Reaktion an diesem Punkt zu bestimmen.

Das System der Erfindung umfasst eine erste Reaktionsmischung, die einen Reaktanden, einen Luminophor und einen Reaktionspartner enthält. Der Reaktand reagiert mit dem Reaktionspartner und der Luminophor partizipiert mit dem Reaktionspartner oder dem Reaktionsprodukt des Reaktionspartners, wobei Elektrochemilumineszenz durch Exposition der Reaktionsmischung an elektrische Energie emittiert wird. Das System umfasst zusätzlich eine zweite Reaktionsmischung, die die gleiche ist, wie die erste Reaktionsmischung, außer, dass man die Reagenzien reagieren ließ, und deshalb umfasst sie reagierte Reagenzien. Eine dritte Reaktionsmischung, die die gleiche ist, wie die erste Reaktionsmischung, außer, dass sie keinen Reaktionspartner enthält, wird auch mit dem System bereitgestellt. Schließlich wird das System mit einem Mittel für getrenntes Exponieren von jeder der ersten, zweiten und dritten Reaktionsmischungen an eine Serie von elektrischen Pulsen bei einem vorgewählten Potential und zu vorgewählten Zeitintervallen und Dauer und einem Mittel zum Messen der Elektrochemilumineszenz zu den selben Intervallen bereitgestellt.

Das Verfahren der Erfindung wird in einem Gerät durchgeführt, das mit einer Elektrode, wie einer elektrochemischen Zelle, bereitgestellt wird. Die biomolekulare Reaktion, die gemäß der Erfindung überwacht wird, wird in dem Gerät unter Verwendung eines Luminophors unter Reaktionsbedingungen durchgeführt, die die Konzentration eines Reaktanden, eines Reaktionspartners oder des Reaktionsprodukts des Reaktionspartners mit der ECL-Intensität in Beziehung bringen, und der Reaktionspartner ist ein Reagenz, das mit dem Reaktanden reagiert und das mit dem Luminophor partizipiert (oder sein Reaktionsprodukt partizipiert), wobei die Emission von ECL verursacht wird.

Die ECL-Intensität der biomolekularen Reaktion wird mittels eines Eingangspotentials, das an der Elektrode verwendet wird, moduliert. Das Eingangspotential induziert den Luminophor zur Emission eines messbaren ECL-Ausgangssignals durch Erzeugen eines angeregten Zustandes des Luminophors, der bei Wellenlängen zwischen etwa 200 Nanometer („nm") und 900 nm bei Umgebungstemperatur luminesziert. Das Eingangspotential wird mit der Zeit inkrementiert (z.B. das RAMP-Verfahren) und das ECL-Ausgangssignal wird als die Antwort auf die Spannungsänderung detektiert. Der ECL-Peak findet beim Potential der elektrochemischen Reaktion (Peakpotential) statt, die durch das Eingangspotential angetrieben wird.

Ein anderer Weg der Erzeugung von ECL ist das Abstufen der Eingangsspannung bei oder höher als dem Peakpotential. Die ECL wird dann als ein scharfer Peak beobachtet, der mit der Zeit abklingt.

Gemäß dem Verfahren der Erfindung wird an der Elektrode eine Serie von kurzen Pulsen verwendet, auch bei einer geringfügig höheren Spannung als das Peakpotential. Das Ergebnis ist eine Serie von ECL-Peaks, die den einzelnen Spannungspulsen entsprechen. In dieser Weise wird zu konstanten Zeitintervallen ein „Probenehmen" des ECL-Signals erhalten und das Fortschreiten einer Reaktion mit der Zeit kann verfolgt werden. Die Intensität dieses modulierten ECL-Signals wird zu jedem Zeitintervall gemessen und die Messungen werden dann demoduliert, um den zeitlichen Verlauf der Reaktion zu erhalten.

Die ECL-Reaktion wird durch das Verfahren der Erfindung durch die Verwendung von engen Spannungspulsen verlangsamt und die Abklinggeschwindigkeit aufgrund der biomolekularen Reaktion wird mit der Abklinggeschwindigkeit aufgrund der ECL-Reaktion verglichen. (Bei einer ECL-Reaktion, bei welcher keine enzymatische Reaktion vor sich geht, wird ein langer Puls bei einem hohen Wert eine ECL-Intensität bereitstellen, die über die Zeit abklingt.) Im Zeitintervall zwischen Pulsen diffundiert neues Material zu der Elektrode und ist bereit zu reagieren, wenn der nächste Spannungspuls kommt, deshalb ist jeder ECL-Peak nur geringfügig niedriger als der letzte.

Mehrere Parameter können geregelt werden, wie das Pulspotential und die Dauer, das Restpotential (d.h. das Potential während dem Intervall zwischen Pulsen) und die Zeit zwischen jedem Puls sowie die Konzentration der Reaktanden, um bessere Bedingungen für Geschwindigkeitsmessungen für jede besondere biomolekulare Reaktion bereit zu stellen, wie für den Fachmann ersichtlich sein wird.

Wenn die Serie von elektrischen Pulsen bei einem vorgewählten Potential und zu vorgewählten konstanten Zeitintervallen und konstanter Dauer zur Modulierung des ECL-Ausgangssignals verwendet wird, wird die Intensität der resultierenden Lumineszenz zu den gleichen Intervallen gemessen, um eine zeitlich festgelegte Serie von Werten bereit zu stellen, die als fortschreitende Reaktion (P) bezeichnet wird. Der gleiche Versuch wird wiederholt, außer, dass das Erreichen des Abschlusses ermöglicht wird, bevor die ECL-Intensität durch Pulsen und Messen von Lumineszenz unter den gleichen Bedingungen gemessen wird, um eine zeitlich festgelegte Serie von Werten bereit zu stellen, die als abgeschlossene Reaktion (C) bezeichnet wird. Der gleiche Versuch wird ein drittes Mal in der Abwesenheit des Reaktionspartners wiederholt und die ECL-Intensität wird zu den gleichen Intervallen gemessen, um eine zeitlich festgelegte Serie von Werten bereit zu stellen, die als Kontrolle (B) bezeichnet wird.

Der zeitliche Verlauf, Konzentration gegen Zeit, der Reaktion wird durch Demodulierung der Intensitätsmessungen bestimmt. Dies wird durch Subtrahieren der Kontrolle (B) von der fortschreitenden Reaktion (P) und Teilen durch die Differenz der abgeschlossenen Reaktion (C) minus die Kontrolle (B) erreicht. Entsprechend wird die enzymatische Reaktion (P) durch die folgende Formel normalisiert (N):

Der zeitliche Verlauf wird mit einem bekannten Standard verglichen, um die Konzentration über die Zeit zu bestimmen, und die Reaktionsgeschwindigkeit kann zu jedem Zeitpunkt durch Verwenden der ersten Ableitung (Tangentensteigung) an diesem Punkt an der Konzentration-gegen-Zeit-Kurve bestimmt werden.

Das Verfahren der vorliegenden Erfindung, wie es bei enzymatischen Reaktionen verwendet wird, ist im Allgemeinen zur Messung der Geschwindigkeit von Oxidoreduktasereaktionen geeignet. Oxidoreduktasen katalysieren Oxidations-Reduktions-Reaktionen und werden in sechs Kategorien klassifiziert, wie sie auf (1) > CH-OH; (2) > C=O; (3) > C=CH-; (4) > CH-NH2; (5) > CH-NH-; und (6) NADH; NADPH wirken.

Die Kategorie von Oxidoreduktasen, die besonders für das Verfahren der vorliegenden Erfindung geeignet ist, ist die der Dehydrogenasen. Als eine Gruppe erfordern Dehydrogenasen für ihre Aktivität einen Co-Faktor. Ein Co-Faktor ist eine Nichtproteinkomponente und er kann ein Metallion oder ein organisches Molekül, das ein Coenzym genannt wird, sein. Geeignete Co-Faktoren für Dehydrogenasen (sowie Oxidasen und andere Enzyme) werden in der Literatur beschrieben und sind auf dem Fachgebiet bekannt. Typische Coenzyme für Dehydrogenasen sind zum Beispiel Nicotinamidadenindinucleotid (NADH) und Nicotinamidadenindinucleotidphosphat (NADPH).

Im Allgemeinen kann eine Reaktion, die von einer Dehydrogenase katalysiert wird, unter Verwendung von NADH als ein Beispiel wie folgt beschrieben werden: reduziertes Substrat + NAD+ = oxidiertes Substrat + NADH und die Reaktion kann in jede Richtung ablaufen. Das Substrat ist das Molekül, an welchem das Enzym die katalytische Wirkung ausübt. Beispiele von reduzierten Substraten schließen Isocitrat, Ethanol, Laktat, Malat und Glucose-6-phosphat ein.

Gemäß dem Enzymgeschwindigkeitsmessverfahren der vorliegenden Erfindung werden Substanzen (Co-Faktoren) verwendet, die ECL-aktiv (d.h. der Reaktionspartner) sind und die mit dem Reaktanden einer enzymatischen Reaktion co-reagieren. Alternativ kann die ECL-aktive Substanz das Reaktionsprodukt des Reaktionspartners sein. Wie vorstehend aufgeführt, schließen die Co-Faktoren NADH und NADPH und die jeweiligen oxidierten Formen davon, NAD+ und NADP+, die besonders für eine Verwendung mit Dehydrogenasen geeignet sind, und Wasserstoffperoxid (H2O2), das besonders für eine Verwendung mit Oxidasen geeignet ist, ein.

Die enzymatische Reaktion muss die ECL-aktive Substanz herstellen oder verbrauchen. Wenn der Vorgang stattfindet, wird die Substanz für ECL verwendet, wobei die Konzentration der Substanzen mit der ECL-Intensität in Beziehung gebracht wird. Zum Beispiel wird NADH, das in der folgenden Reaktion hergestellt wird, zur Messung der Enzymreaktionsgeschwindigkeit für Glucose-6-phosphat-Dehydrogenase verwendet: Glucose-6-phosphat + NAD+ = 6-Phosphogluconat + NADH(1) NADH + Ru(bpy)32+ = ECL(2) wobei die Reaktion (1) in der Gegenwart von Glucose-6-phosphat-Dehydrogenase und Ru(bpy)3+2 durchgeführt wird. Wenn NADH hergestellt wird, reagiert es mit Ru(bpy)32+ gemäß der Reaktion (2), wenn elektrische Pulse verwendet werden, um ECL zu erzeugen. Die Intensität der ECL wird sich mit einer erhöhten Herstellungsgeschwindigkeit von NADH erhöhen und sie wird sich mit einer erniedrigten Herstellungsgeschwindigkeit von NADH erniedrigen.

Alternativ wird NADH, das in der folgenden Reaktion verbraucht wird, zur Messung der Enzymreaktionsgeschwindigkeit für Laktatdehydrogenase (LDH) verwendet: Pyruvat + NADH = NAD+ + Laktat(3) NADH + Ru(bpy)32+ = ECL(4) wobei die Reaktion (3) in der Gegenwart von LDH und Ru(bpy)32+ durchgeführt wird. Wenn NADH verbraucht wird, reagiert es gemäß der Reaktion (4) weniger mit Ru(bpy)32+, wenn elektrische Pulse verwendet werden, um ECL zu erzeugen. Die Intensität der ECL wird sich mit einer erhöhten Verbrauchsgeschwindigkeit von NADH erniedrigen und sie wird sich mit einer erniedrigten Verbrauchsgeschwindigkeit von NADH erhöhen.

NADH ist ein besonders geeigneter Coreaktand zur Verwendung gemäß dem Enzymgeschwindigkeitsmessverfahren der vorliegenden Erfindung, da es mit zahlreichen enzymatischen Reaktionen partizipiert. Das Substrat wird durch das Enzym zu Produkten umgewandelt und bei dem Vorgang wird NADH zu NAD+ umgewandelt oder umgekehrt, abhängig von der Reaktion. Wenn NADH hergestellt (oder verbraucht) wird, partizipiert es mit dem Luminophor, wobei ECL erhalten wird. Die Intensität des Lichts ist proportional zur Konzentration von NADH zu jedem Zeitpunkt. Die Änderung bei der NADH-Konzentration steht mit der Aktivität des Enzyms, welches die Reaktion katalysiert, in Beziehung. Das Signal wird gegen die Zeit nach einer Punkt-für-Punkt-Substraktion des Hintergrunds und Normalisieren des Signals des Luminophors mit der anfänglichen (oder am Ende vorhandenen) Konzentration von NADH aufgezeichnet, wobei ein zeitlicher Verlauf erhalten wird.

Der Reaktionsmechanismus zwischen dem Ru(bpy)32+ und NADH als der Coreaktand, der letztlich die Elektrochemilumineszenz erzeugt, bezieht einen ersten Schritt von Oxidieren von Ru(bpy)32+ an der Elektrode gemäß (1) wie folgt ein: Ru(bpy)32+ → Ru(bpy)33+ + e(1).

NADH wird an der Elektrode auch oxidiert, gefolgt von einer Protonenabgabe, die das starke Reduktionsmittel NAD-Radikal gemäß (2) wie folgt herstellt:

Als Nächstes reagiert das NAD-Radikal mit Ru(bpy)33+ in einer homogenen Reaktion (3). Die Energieübertragung ist ausreichend, um den Rutheniumkomplex in seinen angeregten Zustand wie folgt zu heben:

Durch Zurückfallen in den Grundzustand emittiert das Identifizierungsmolekül detektierbares Licht bei 620 nm gemäß der Reaktion (4) wie folgt: Ru(bpy)32+* → Ru(bpy)33+ hv(4)

Das Enzymgeschwindigkeitsmessverfahren der Erfindung wird durch Mischen aller Reagenzien in einem Probenröhrchen durchgeführt und das Enzym wird zuletzt zugegeben.

Nach der Zugabe des Enzyms wird die Probe in die elektrochemische Zelle eines ORIGEN®-Analysegeräts gezogen. Eine Serie von elektrischen Pulsen wird bei konstanten Zeitintervallen und konstanter Dauer verwendet. (Das ORIGEN®-Analysegerät erzeugt eine Rechteckwelle, aber Dreieck- oder Sinuswellen können auch verwendet werden.) Die resultierende Lumineszenz von dem Luminophor wird gemessen und zeigt die Menge der Produkte, die gebildet werden, an, wenn die enzymatische Reaktion fortschreitet.

Das Verfahren der vorliegenden Erfindung, wenn es für Bindungsreaktionen verwendet wird, kann zur Überwachung von Reaktionen wie jenen, die nachstehend aufgelistet sind, verwendet werden:

Antikörper-Antigen, wie CEA zu anti-CEA;

Ligand-Rezeptor, wie ein Hormon, das an seinen Rezeptor bindet;

Avidin-Biotin;

Basenpaarung, wie bei DNA-Hybridisierungsreaktionen;

Lecitine-Kohlenwasserstoffe; und

Enzym-Inhibitor.

Bei der Messung von Bindungsreaktionsgeschwindigkeiten werden vor dem Bindungsereignis zwei Reagenzien hergestellt. Wenn eine Antikörper-Antigen-Reaktion einbezogen ist, wird zum Beispiel der Luminophor an den Antikörper (wobei der Antikörper der Reaktand ist), dessen Bindungsgeschwindigkeit bestimmt werden soll, gebunden und das Antigen (der Reaktionspartner) wird an ein Magnetkügelchen gebunden. Das ORIGEN®-Analysegerät kann zum Dispensieren von Proben, die Magnetkügelchen enthalten, und zum Durchführen der Analyse verwendet werden. Die Proben werden in die elektrochemische Fließzelle des Analysegeräts hineingezogen und die mit Antigen versehenen Magnetkügelchen werden einheitlich auf die Arbeitselektrode aus dem Fließstrom durch Platzieren des Magneten direkt darunter aufgebracht. Das Bindungsereignis wird initiiert und schreitet fort durch kontinuierliches Ziehen von markiertem Antikörper durch die elektrochemische Fließzelle des Analysegeräts. Wenn das Bindungsereignis abläuft, bindet die ECL-aktive Markierung an das Magnetkügelchen. Eine Serie von elektrischen Pulsen wird wie vorstehend beschrieben verwendet. Ein Anstieg bei der ECL findet statt, wenn das Binden abläuft, und weist auf ein Fortschreiten der Reaktion hin. Die ECL-Intensität wird dann demoduliert, um den zeitlichen Verlauf der Reaktion zu erhalten.

Luminophore, die gemäß der vorliegenden Erfindung verwendet werden können, fallen in zwei Klassen, nämlich organische Verbindungen und anorganische Verbindungen. Die organischen Verbindungen schließen fluoreszente oder phosphoreszente polyaromatische Kohlenwasserstoffe, wie Rubren, 9,10-Diphenylanthracen, Phthalocyanine und Phenanthren ein. Die anorganischen Verbindungen schließen fluoreszente oder phosphoreszente Übergangsmetallchelatverbindungen wie Rutheniumtrisbipyridin, Osmiumtrisbipyridin, Platindiphosphat, Mo6Cl122–; organometallische Verbindungen; Seltenerdmetallchelatverbindungen wie Terbiumthenoyltrifluoracetonat; Europiumdibenzoylmethid; und Hauptgruppenchelatverbindungen wie Siliziumphthalocyanin ein. Besonders nützliche Luminophore sind Ru-enthaltende und Os-enthaltende Verbindungen.

Die Luminophore, die in U.S. Patent Nr. 5,310,687 offenbart werden, können als Luminophore gemäß der vorliegenden Erfindung verwendet werden und unter jenen, die offenbart sind, sind Rutheniumkomplexe wie Ru(2,2'-bipyridin)32+ bevorzugt.

Die besonderen Markierungen, auf welche die vorliegende Erfindung Bezug nimmt, sind elektrochemilumineszent. Sie können oft ohne ihre Oxidation oder Reduktion in einen lumineszenten Zustand angeregt werden, durch Exponieren der Verbindungen an elektromagnetische Strahlung oder an eine chemische Energiequelle, wie die, die durch typische Oxalat-H2O2-Systeme erzeugt wird. Zusätzlich kann eine Lumineszenz dieser Verbindungen durch elektrochemische Verfahren, die ihre Oxidation und Reduktion nicht erfordern, induziert werden. Das Verfahren der vorliegenden Erfindung hat mit dem Anregen dieser Markierungen mit elektrischen Pulsen zu tun.

Es wurde von umfangreicher Arbeit über Verfahren zur Detektion von Ru(2,2'-bipyridin)32+ unter Verwendung von photolumineszenten, chemilumineszenten und elektrochemilumineszenten Mitteln berichtet: Rubenstein und Bard (1981), „Electrogenerated Chemiluminescence. 37. Aqueous Ecl Systems based on Ru(2,2'-bipyridine)22+ and Oxalate or Organic Acids", J. Am. Chem. Soc. 103, S. 512–516; und White und Bard (1982), "Electrogenerated Chemiluminescence. 41. Electrogenerated Chemiluminescence and Chemiluminescence of the Ru(bpy)32+-S2O82-System in Acetonitrile-Water Solutions", 104, S. 6891. Diese Arbeit zeigt, dass helle orangefarbene Chemilumineszenz auf der wässrigen Reaktion von chemisch erzeugtem oder elektroerzeugtem Ru(bpy)33+ mit starken Reduktionsmitteln, die als Zwischenprodukte bei der Oxidation von Oxalationen oder anderen organischen Säuren hergestellt werden, basieren kann. Lumineszenz kann auch in Lösungen von organischen Lösungsmitteln und H2O durch die Reaktion von elektroerzeugtem oder chemisch erzeugtem Ru(bpy)31+ mit starken Oxidationsmitteln, die während der Reduktion von Peroxydisulfat erzeugt werden, erhalten werden. Ein dritter Mechanismus zur Erzeugung von Elektrochemilumineszenz von Ru(bpy)32+ bezieht die Oszillation eines Elektrodenpotentials zwischen einem Potential, das ausreichend negativ zur Herstellung von Ru(bpy)31+ ist und ausreichend positiv zur Herstellung von Ru(bpy)33+ ist, ein. Diese drei Verfahren werden „oxidative Reduktion", „reduktive Oxidation" bzw. „das regenerative Ru(bpy)33+/+-System" genannt.

Das oxidative Reduktionsverfahren kann in Wasser durchgeführt werden und erzeugt eine intensive, wirksame, stabile Lumineszenz, die relativ unempfindlich ist für die Gegenwart von Sauerstoff oder Verunreinigungen. Diese Lumineszenz von Ru(bpy)32+ hängt von der Gegenwart von Oxalat oder anderen organischen Säuren wie Pyruvat, Laktat, Malonat, Tartrat und Citrat und Mitteln, die oxidativ Ru(bpy)33+-Spezies herstellen, ab. Diese Oxidation kann chemisch durch so starke Oxidationsmittel wie PbO2 oder ein Ce(IV)-Salz durchgeführt werden. Sie kann elektrochemisch durch ein ausreichend positives Potential, das entweder kontinuierlich oder diskontinuierlich verwendet wird, durchgeführt werden. Geeignete Elektroden für die elektrochemische Oxidation von Ru(bpy)33+ sind zum Beispiel Pt, pyrolytisches Graphit und Glaskohlenstoff.

Das reduktive Oxidationsverfahren kann in teilweise wässrigen Lösungen, die ein organisches Colösungsmittel wie zum Beispiel Acetonitril enthalten, durchgeführt werden. Diese Lumineszenz hängt von der Gegenwart von Peroxydisulfat und einem Mittel zur reduktiven Erzeugung einer angeregten Spezies ab. Die Reduktion kann elektrochemisch durch ein ausreichend negatives Potential, das entweder kontinuierlich oder diskontinuierlich verwendet wird, durchgeführt werden. Eine geeignete Elektrode für die elektrochemische Reduktion von Ru(bpy)32+ ist zum Beispiel eine polierte Glaskohlenstoffelektrode.

Das regenerative Ru(bpy)33+/+-System kann in organischen Lösungsmitteln wie Acetonitril oder in teilweise wässrigen Systemen durch Pulsen eines Elektrodenpotentials zwischen einem Potential, das ausreichend negativ zur Reduktion von Ru(bpy)32+ ist, und einem Potential, das ausreichend positiv zur Oxidation von Ru(bpy)32+ ist, durchgeführt werden.

Eine geeignete Elektrode für ein solches regeneratives System ist zum Beispiel eine Pt-Elektrode. Dieses System verbraucht keine chemischen Reagenzien und kann prinzipiell für eine nicht eingeschränkte Dauer ablaufen.

Diese drei Verfahren zur Herstellung von lumineszenten Ru-enthaltenden Verbindungen haben die sich wiederholende Oxidation-Reduktion oder Reduktion-Oxidation der Ru-enthaltenden Verbindung gemeinsam. Die Lumineszenz von Lösungen, die diese Verbindungen enthalten, ist deshalb stark vom elektrischen Potential der verwendeten Energiequelle abhängig und ist deshalb für die Gegenwart der Ru-enthaltenden Verbindung stark diagnostisch.

Gemäß der vorliegenden Erfindung kann eine chemische Einheit mit der folgenden Formel verwendet werden: [M(P)m(L1)n(L2)o(L3)p(L4)q(L5)r(L6)s]t(D)u wobei M Ruthenium oder Osmium ist; P ein vielzähniger Ligand von M ist; L1, L2, L3, L4, L5 und L6 Liganden von M sind, wobei jeder gleich zu oder unterschiedlich von jedem anderen Liganden sein kann; D eine Substanz ist, die kovalent an einen oder mehrere von P, L1, L2, L3, L4, L5 oder L6 durch eine oder mehrere Amid- oder Aminverknüpfungen gebunden ist; m eine ganze Zahl von gleich oder größer als 1 ist; jedes von n, o, p, q, r und s null oder eine ganze Zahl ist; t eine ganze Zahl von gleich oder größer als 1 ist; u eine ganze Zahl von gleich oder größer als 1 ist; und P, L1, L2, L3, L4, L5, L6 und D von solcher Zusammensetzung und Anzahl sind, dass die chemische Einheit zur Emission elektromagnetischer Strahlung induziert werden kann und dass die Gesamtanzahl der Bindungen zu M, die durch die Liganden von M bereitgestellt werden, gleich der Koordinationszahl von M ist.

Die Erfindung verwendet auch Verbindungen, die besonders als Zwischenprodukte zum Binden einer lumineszenten Ruthenium- oder Osmium-enthaltenden Markierung an Aminogruppen von chemischen, biochemischen und biologischen Substanzen geeignet sind. Diese Zwischenprodukte sind folglich besonders zur Gestaltung der chemischen Einheiten geeignet, die gemäß der vorliegenden Erfindung verwendet werden. Die Zwischenprodukte sind die Mono- und Di-N-hydroxysuccinimidester von Ruthenium- oder Osmiumbis(2,2'-bipyridin)(2,2'-bipyridin-4,4'-dicarbonsäure) und ihren Salzen; und Ruthenium- oder Osmiumbis(2,2'-bipyridin)(4,4'-di(chlormethyl)-2,2'-bipyridin). Diese Verbindungen können durch auf dem Fachgebiet bekannte Mittel synthetisiert werden.

Die vorliegende Erfindung kann auch die Ruthenium-enthaltenden oder Osmium-enthaltenden chemischen Einheiten in Bindungsverfahren für Geschwindigkeitsbestimmungen, die Analyte von Interesse einbeziehen, verwenden. (A)k(D)u wobei A eine Verbindung ist, die zur wiederholten Emission von ECL durch direkte Exposition an eine elektrochemische Energiequelle induziert werden kann; D eine Substanz wie ein Nucleotid, ein Polynucleotid, ein von Serum abgeleiteter Antikörper oder ein monoklonaler Antikörper (und andere Substanzen, wie sie später in dieser Beschreibung beschrieben werden) ist, die an A gebunden ist; k eine ganze Zahl von gleich oder größer als 1 ist, und u eine ganze Zahl von gleich oder größer als 1 ist, umfassend a) Bilden einer Reaktionsmischung unter geeigneten Bedingungen, die die chemische Einheit enthält, und b) Induzieren der chemischen Einheit zur wiederholten Emission von ECL durch Verwenden von modulierter elektrischer Energie und dann Modulieren der ECL gemäß dem Verfahren der vorliegenden Erfindung.

In einer Ausführungsform der Erfindung ist M Ruthenium. In einer anderen Ausführungsform der Erfindung ist M Osmium.

Die chemische Einheit muss mindestens einen vielzähnigen Liganden von M aufweisen. Wenn die Einheit mehr als einen vielzähnigen Liganden aufweist, können die vielzähnigen Liganden gleich oder unterschiedlich sein. Vielzähnige Liganden schließen aromatische und aliphatische Liganden ein. Geeignete aromatische vielzähnige Liganden schließen aromatische heterocyclische Liganden ein. Bevorzugte aromatische heterocyclische Liganden sind Stickstoff-enthaltend, wie zum Beispiel Bipyridyl, Bipyrazyl, Terpyridyl, Phenanthrolyl und Porphyrine.

Geeignete vielzähnige Liganden können unsubstituiert oder durch jedweden einer großen Anzahl von auf dem Fachgebiet bekannten Substituenten substituiert sein. Geeignete Substituenten schließen zum Beispiel Alkyl, substituiertes Alkyl, Aryl, substituiertes Aryl, Aralkyl, substituiertes Aralkyl, Carboxylat, Carboxaldehyd, Carboxamid, Cyano, Amino, Hydroxy, Imino, Hydroxycarbonyl, Aminocarbonyl, Amidin, Guanidinium, Ureid, Maleimid, Schwefel-enthaltende Reste, Phosphor-enthaltende Reste, und den Carboxylatester von N-Hydroxysuccinimid ein.

Zusätzlich kann mindestens einer von L1, L2, L3, L4, L5 und L6 ein vielzähniger aromatischer heterocyclischer Ligand sein. Darüber hinaus kann mindestens einer dieser vielzähnigen aromatischen heterocyclischen Liganden Stickstoff enthalten. Geeignete vielzähnige Liganden schließen Bipyridyl, Bipyrazyl, Terpyridyl, Phenanthroyl, ein Porphyrin, substituiertes Bipyridyl, substituiertes Bipyrazyl, substituiertes Terpyridyl, substituiertes Phenanthroyl oder ein substituiertes Porphyrin ein, sind aber nicht darauf eingeschränkt. Diese substituierten vielzähnigen Liganden können mit einem Alkyl, substituierten Alkyl, Aryl, substituierten Aryl, Aralkyl, substituierten Aralkyl, Carboxylat, Carboxaldehyd, Carboxamid, Cyano, Amino, Hydroxy, Imino, Hydroxycarbonyl, Aminocarbonyl, Amidin, Guanidinium, Ureid, Maleimid, einem Schwefel-enthaltenden Rest, einem Phosphor-enthaltenden Rest oder dem Carboxylatester von N-Hydroxysuccinimid substituiert sein.

Die chemische Einheit kann zwei zweizähnige Liganden enthalten, wobei jeder Bipyridyl, Bipyrazyl, Terpyridyl, Phenanthrolyl, substituiertes Bipyridyl, substituiertes Bipyrazyl, substituiertes Terpyridyl oder substituiertes Phenanthrolyl ist.

Alternativ kann die chemische Einheit drei zweizähnige Liganden enthalten, wobei jeder Bipyridyl, Bipyrazyl, Terpyridyl, Phenanthrolyl, substituiertes Bipyridyl, substituiertes Bipyrazyl, substituiertes Terpyridyl oder substituiertes Phenanthrolyl ist. Die chemische Einheit kann Ruthenium umfassen. In einer anderen Ausführungsform der Erfindung umfasst die chemische Einheit Ruthenium, zwei zweizähnige Bipyridyl-Liganden und einen substituierten zweizähnigen Bipyridyl-Liganden. In noch einer anderen Ausführungsform kann die chemische Einheit einen vierzähnigen Liganden wie ein Porphyrin oder substituiertes Phorphyrin enthalten.

Die chemische Einheit kann einen oder mehrere einzähnige Liganden aufweisen, wobei eine große Vielzahl davon auf dem Fachgebiet bekannt ist. Geeignete einzähnige Liganden schließen zum Beispiel Kohlenmonoxid, Cyanide, Isocyanide, Halogenide, und aliphatische, aromatische und heterocyclische Phosphine, Amine, Stibane und Arsine ein.

Besonders bevorzugte Ausführungsformen der chemischen Einheit umfassen Bis(2,2'-bipyridyl)-Ruthenium(II) und Tris(2,2'-bipyridyl)-Ruthenium(II).

Einer oder mehrere der Liganden von M können an zusätzliche chemische Markierungen, wie zum Beispiel radioaktive Isotope, fluoreszente Komponenten oder zusätzliche lumineszente Ruthenium- oder Osmium-enthaltende Zentren gebunden werden.

Geeignete Substanzen (D) schließen viele biologische Substanzen, zum Beispiel ganze Zellen, Viren, subzelluläre Teilchen, Proteine, Lipoproteine, Glycoproteine, Peptide, Nucleinsäure, Polysaccharide, Lipopolysaccharide, Lipide, Fettsäuren, zelluläre Metabolite, Hormone, pharmakologische Mittel, Tranquilizers, Barbiturate, Alkaloide, Steroide, Vitamine, Aminosäuren und Zucker ein. Ganze Zellen können tierisch, pflanzlich oder bakteriell sein und können lebend oder tot sein. Beispiele schließen Pflanzenpathogene wie Pilze und Nematoden ein. In dieser Anmeldung bedeutet der Ausdruck „subzelluläre Teilchen" subzelluläre Organellen, Membranteilchen wie von aufgebrochenen Zellen, Fragmente von Zellwänden, Ribosomen, Multienzymkomplexe und andere Teilchen, die von lebenden Organismen abgeleitet werden können. Auch in dieser Anmeldung bedeutet Nucleinsäuren chromosomale RNA, Plasmid-RNA, virale RNA und rekombinante INA, die von vielfachen Quellen abgeleitet sind. Nucleinsäuren schließen auch RiAs, zum Beispiel Messenger-RiAs, ribosomale IRNAs und Transfer-RNAs ein. Polypeptide schließen zum Beispiel Enzyme, Transportproteine, Rezeptorproteine und Strukturproteine wie virale Hüllproteine ein. Bevorzugte Polypeptide sind Enzyme und von Serum abgeleitete Antikörper. Besonders bevorzugte Polypeptide sind monoklonale Antikörper. Hormone schließen zum Beispiel Insulin und T4 Thyroid-Hormon ein. Pharmakologische Mittel schließen zum Beispiel Herzglycoside ein. Es liegt auch innerhalb des Umfangs dieser Erfindung, synthetische Substanzen einzuschließen, die biologischen Materialien chemisch ähnlich sind, wie synthetische Peptide, synthetische Nucleinsäuren, und synthetische Membrane, Vesikel und Liposome. Mit dem Vorstehenden ist keine umfassende Auflistung der biologischen Substanzen, die zur Verwendung in dieser Erfindung geeignet sind, beabsichtigt, sondern es ist nur zur Veranschaulichung des großen Umfangs der Erfindung gedacht.

Biologische und nicht biologische Substanzen (D) sind kovalent an einen Liganden von M durch eine oder mehrere Amid- oder Aminverknüpfungen gebunden. Im Falle von Amidverknüpfungen können die Verknüpfungen so orientiert sein, dass das Material (D) direkt entweder an das Carbonyl oder an den Stickstoff der Amidverknüpfung gebunden ist. Diese chemischen Einheiten können ionisiert sein. Falls dem so ist, gilt es auf dem Fachgebiet als selbstverständlich, dass viele unterschiedliche Gegenionen zur Neutralisierung der Ladung von Herstellungen der chemischen Einheit dienen werden. Geeignete Kationen schließen zum Beispiel H+, NH4+, Guanidinium, Ag+, Li+, N+, K+, Mg2+ und Mn2+ ein. Geeignete Anionen schließen zum Beispiel Halogenide, OH, Carbonat, SO42–, Hexafluorphosphat und Tetrafluorborat ein.

Die chemischen Einheiten sind auch besonders als Zwischenprodukte zum Binden einer lumineszenten Ruthenium-enthaltenden oder Osmium-enthaltenden Markierung an Aminogruppen von chemischen, biochemischen und biologischen Substanzen geeignet. Diese Zwischenprodukte sind folglich besonders zur Synthese von chemischen Einheiten gemäß der vorliegenden Erfindung geeignet. Die Zwischenprodukte sind die Mono- und Di-N-hydroxysuccinimidester von Ruthenium- und Osmium-4,4'-(dicarboxy)-2,2'-bipyridyl, -bis(2,2'-bipyridyl) und ihren Salzen; und Ruthenium- und Osmium-4,4'-(dichlormethyl)-2,2'-bipyridyl, -bis(2,2'-bipyridyl) und ihren Salzen.

Die chemischen Strukturen dieser Zwischenprodukte und die Verfahren zur Herstellung von ihnen sind im U.S. Patent Nr. 5,310,687, auf welches vorstehend Bezug genommen wurde, dargelegt.

Ein bevorzugtes Verfahren zur Synthese der Ruthenium-enthaltenden N-Hydroxysuccinimidester ist zuerst Rutheniumdichlorbis(2,2'-bipyridin) mit 2,2'-Bipyridin-4,4'-dicarbonsäure in einer heißen wässrigen Methanollösung von Natriumbicarbonat umzusetzen. Nach Ansäuern wird eine wässrige Lösung von NaPF6 zu der Lösung der carboxylierten Rutheniumverbindung gegeben. Das isolierte Hexafluorphosphatsalz des Rutheniumkomplexes wird dann durch Reaktion mit N-Hydroxysuccinimid in der Gegenwart von Dicyclohexylcarbodiimid in Dimethylformamid verestert. Natürlich sind viele Variationen an der Struktur der N-Hydroxysuccinimid-Komponente möglich, ohne im Wesentlichen die Nützlichkeit der Zwischenprodukte zu verändern.

Die Zwischenprodukte können ionisiert sein. Falls dem so ist, gilt es auf dem Fachgebiet als selbstverständlich, dass viele unterschiedliche Gegenionen zur Neutralisierung der Ladung von Herstellungen des Zwischenprodukts und zur Bildung eines Salzes dienen werden. Geeignete Kationen zum Bilden dieser Salze schließen zum Beispiel NH4+, Guanidinium, Ag+, Li+, Na+, K+, Ca2+, Mg2+ und Cd2+ ein. Geeignete Anionen zum Bilden dieser Salze schließen zum Beispiel Halogenide, Carbonat, SO42–, Hexafluorphosphat und Tetrafluorborat ein.

Die Zwischenprodukte sind zum Markieren von Substanzen nützlich, die eine freie Aminogruppe enthalten, welche zum Angreifen des Carboxylatesters und dabei Ersetzen von N-Hydroxysuccinimid oder zum Angreifen der Chlormethylgruppe und dabei Ersetzen von Chlorid in der Lage ist.

Die Erfahrung der Anmelder mit Ru(bpy)32+-markierten Substanzen weist auf die Vorteile der Verwendung von Ruthenium-enthaltenden und Osmium-enthaltenden Verbindungen als chemische Markierungen hin. Sie sind für lange Zeitdauern stabil und können wirksam an eine große Vielzahl von chemischen, biochemischen und biologischen Materialien gebunden werden. Die Markierungen sind sicher und relativ günstig. Sie ergeben ein stark charakteristisches Signal und kommen nicht in der Natur vor. Messungen, die auf der Lumineszenz der Markierungen basieren, sind empfindlich, schnell und reproduzierbar. Es gibt sehr wenig Beeinflussung der Detektion, die auf der Lumineszenz dieser Markierungen basiert, durch solche Komponenten wie Phosphat-gepufferte Salzlösung, Tween\(ein grenzflächenaktiver Stoff), Lebergewebeextrakt oder Serum. Eine auf Lumineszenz basierende Messung dieser Markierungen zerstört die Probe oder die markierten Materialien nicht und kann wiederholt durchgeführt werden. Das Signal wird wiederholt durch jedes Molekül der Markierung erzeugt, wobei die Empfindlichkeit, mit welcher diese Markierungen detektiert werden können, gesteigert wird.

Geeignete Bedingungen zur Bildung der Reaktionsmischung werden dem Fachmann bekannt sein und werden vom Typ der einbezogenen Reaktionsmischung abhängen. Zum Beispiel können geeignete Bedingungen für eine wässrige Reaktionsmischung passende Konzentrationen der chemischen Einheit und anderer Reagenzien wie Oxidationsmitteln, pH-Wert, Salzkonzentration und dergleichen einschließen. Für eine feste Probe können geeignete Bedingungen zum Bilden einer Reaktionsmischung die Zugabe einer leitenden Flüssigkeit einschließen.

Die vorliegende Erfindung kann Osmium-enthaltende Einheiten sowie Ruthenium-enthaltende Einheiten und die große Vielzahl von lumineszenten Einheiten, die durch Variieren der chemischen Struktur der Liganden hergestellt werden können, verwenden. Jede dieser Variationen am Metall und den Liganden kann den genauen Wert der Energieaufnahme, die zur Erzeugung des lumineszenten angeregten Zustandes erforderlich ist, verändern. In ähnlicher Weise wird die Wellenlänge der emittierten elektromagnetischen Strahlung von der Natur und der Umgebung des Ruthenium-enthaltenden oder Osmium-enthaltenden Materials abhängen. Im Allgemeinen wird Photolumineszenzanregung und -emission mit elektromagnetischer Strahlung bei Wellenlängen von zwischen etwa 200 Nanometer und etwa 900 Nanometer stattfinden. Chemilumineszenz- und Elektrochemilumineszenzemission wird im Allgemeinen mit der emittierten elektromagnetischen Strahlung bei Wellenlängen zwischen etwa 200 Nanometer und etwa 900 Nanometer stattfinden. Das Potential, bei welchem die Reduktion oder Oxidation der chemischen Einheit stattfinden wird, hängt von ihrer genauen chemischen Struktur sowie von Faktoren wie dem pH-Wert der Lösung und der Natur der verwendeten Elektrode ab. Im Allgemeinen ist es auf dem Fachgebiet bekannt, wie die optimalen Emissions- und Anregungswellenlängen in einem photolumineszenten System und das optimale Potential und die Emissionswellenlänge eines elektrochemilumineszenten und chemilumineszenten Systems bestimmt werden.

BEISPIELE

Ein ORIGEN®-Analysegerät wurde bei der folgenden experimentellen Arbeit verwendet. Der reguläre Betrieb des Gerätes ist zur Detektion von einem ECL-Ergebnis pro Probe, bevor diese Probe in den Abfall gespült wird, konfiguriert. Wir modifizierten den regulären Betrieb, so dass jedes Röhrchen einzeln analysiert werden konnte. Das heißt, die Inhalte von jedem Röhrchen wurden in die Zelle gezogen und man ermöglichte, dass sie dort blieben, während eine Serie von Pulsen bei der Probe verwendet wurde. Jeder Puls stellte einen Datenpunkt bereit, so dass eine Serie von Datenpunkten für jede Probe erhalten wurde.

Im Falle von enzymatischen Reaktionen enthielt die erste Probe, die man laufen ließ, (fortschreitende Reaktion) typischerweise das Ru(bpy)32+-Molekül und alle Reagenzien für die enzymatische Reaktion, außer das Enzym. Das Röhrchen wurde in das Karussell des Analysegeräts gegeben und das Analysegerät wurde gestartet. (Die Oberfläche der Elektrode wurde vor dem Betrieb gereinigt.)

Die Probenmischung, die noch in dem Röhrchen war, wurde durchgewirbelt (engl. vortex). An diesem Punkt war das Analysegerät programmiert, die Betriebseinrichtung anzuhalten und zu mobilisieren, wobei das Enzym hineinpipettiert wurde. Als dies durchgeführt worden war, wurde der Betrieb des Analysegeräts mit der sofortigen Aufzeichnung der Zeit in Sekunden wieder aufgenommen. Mit jedem Spannungspuls, der ein ECL-Ausgangssignal erzeugte, wurde eine Zeitmarke bereitgestellt. In dieser Weise wurde ein zeitlicher Verlauf des ECL-Signals erhalten.

Nachdem alle Daten für das erste Röhrchen gesammelt worden waren, folgte ein zweites Probenröhrchen, das die gleiche Zusammensetzung wie das erste enthielt. Außer, dass man in diesem Fall bei dem Enzym die Zeit wirken ließ und die Reaktion den Abschluss erreicht hatte. Die Probe wurde dann dem gleichen Spannungsschema ausgesetzt. Die Ergebnisse vom ersten Röhrchen wurden mit den Ergebnissen vom zweiten Röhrchen, die nur das ECL-Ausgangssignal (oder ECL-Abklingen) waren, normalisiert. (Alternativ kann für diesen Zweck ein Röhrchen getestet werden, das NADH und Ru(bpy)32+ in den gleichen Konzentrationen wie das erste Röhrchen enthält.)

Für Hintergrundzwecke ließ man auch ein drittes Röhrchen laufen, das alles außer dem Substrat enthielt. Die ECL-Ergebnisse von diesem Röhrchen wurden von sowohl dem fortschreitenden Röhrchen als auch dem abgeschlossenen Röhrchen vor der numerischen Normalisierung Punkt für Punkt subtrahiert.

Das Gerät nahm mit einer Rate von einem Datenpunkt pro 10 Millisekunden („msec") Proben. Deshalb führte ein Puls, der 100 msec lang war, zum Beispiel zu 10 Probenahmen während dieser Zeitdauer.

Man folgte einem ähnlichen Versuchsprotokoll für Antikörper-Antigen-Geschwindigkeitsmessungen, wie nachstehend genauer erläutert wird.

BEISPIEL 1 Enzymatische Reaktion, wobei NADH erzeugt wird.

Glucose-6-phosphat-Dehydrogenase („G-6-PDH") katalysiert die Oxidation von Glucose-6-phosphat zu 6-Phosphogluconat mit NAD+ als ein Coreaktand, der zu NADH reduziert wird. Die Reaktion ist wie folgt:

Der Versuch wurde in 50 mM Phosphatpuffer bei einem pH-Wert von 7,5 durchgeführt. Ein pH-Wert von 7,0 bis 7,5 kann verwendet werden und ein Carbonatpuffer kann anstelle des Phosphats verwendet werden. Die Lösung enthielt 0,53 g/l Triton X-100. Der Puffer wurde sowohl als der Testpuffer als auch als der Inkubationspuffer für die Probe verwendet. Die Konzentration an Luminophor betrug 1E-4 M Ru(bpy)32+ und typische Konzentrationen für den Luminophor können von etwa 1E-6 M bis etwa 1E-4 M sein.

Die Probe wurde von dem Röhrchen in die elektrochemische Zelle des ORIGEN®-Analysegeräts zu der Zeit, die als null aufgezeichnet wurde, gezogen. Während sie in der Zellkammer war, war die Elektrode Gegenstand einer Serie von Pulsen von null bis 1800 Millivolt („mV") gegen Ag/AgCl. Die Pulsdauer betrug 460 Millisekunden („msec") und das Restpotential war null für 250 msec. Typische Pulsraten können von etwa 100 bis etwa 500 Millisekunden sein. Die Anzahl der Pulse war 20 und die Anzahl kann von etwa 10 bis etwa 40 sein.

Man folgte der Kinetik der Reaktion durch Überwachen des ECL-Ausgangssignals mit der Zeit, wenn NADH erzeugt wurde und mit Ru(bpy)32+ reagierte. Die Reaktion erreichte nach etwa 7 Minuten etwa 50% des Abschlusses.

Der Versuch wurde unter den gleichen Bedingungen wiederholt, außer, dass man bis zum Abschluss reagieren ließ, bevor die ECL-Intensität gemessen wurde.

Der Versuch wurde wieder unter den gleichen Bedingungen wiederholt, außer, dass NAD+ nicht zu der Reaktionsmischung gegeben wurde.

Man ließ einen vierten Versuch unter Verwendung der gleichen Reaktanden wie im ersten Lauf in diesem Beispiel laufen, außer, dass die Reaktion unter Verwendung eines Spektrophotometers analysiert wurde. Die Reaktion erreichte nach etwa 7 Minuten etwa 50 des Abschlusses. Die Spektrophotometrieergebnisse wurden mit der normalisierten Kurve des Verfahrens der Erfindung verglichen und sie korrelierten gut.

BEISPIEL 2 Die Inhibierungswirkung der Phosphorgruppe.

Die Versuche von Beispiel 1 wurden wiederholt, außer, dass die Konzentration des Phosphatpuffers variiert wurde, um die Inhibierungswirkung der Phosphorgruppe zu zeigen. Die Ergebnisse, die in der Zeit ausgedrückt sind, die es braucht, um die Hälfte der Menge des Substrats in Produkt umzuwandeln („t½"), sind in der folgenden Tabelle zusammengefasst:

Wenn die Konzentration des Puffers erhöht wurde, stieg t½, was eine Verlangsamung der Kinetik anzeigt. Die Ergebnisse aus den zwei Verfahren stimmten gut überein.

BEISPIEL 3 Enzymatische Reaktion, wobei NADH verbraucht wird.

Laktatdehydrogenase („LDH") katalysiert die Umwandlung von Pyruvat zu Laktat mit NADH als ein Coreaktand, der verbraucht wird, wobei die oxidierte Form NAD+ wie folgt gebildet wird:

Das NADH war in einer Konzentration von 10–2 M mit 10–4 M Ru(bpy)32+ vorhanden und das gleiche Versuchsprotokoll, welchem man in Beispiel 1 folgte, wurde hier wiederholt. Die Elektrode wurde zwanzig Mal bei 1800 mV für 460 msec gepulst und das Restpotential war null für 250 msec. Der gesamte zeitliche Verlauf war etwas über 3000 msec. Die normalisierten Ergebnisse waren gut mit der Spektrophotometrieanalyse vergleichbar.

Wenn diese Reaktion fortschreitet, ist wenig NADH vorhanden, um mit Ru(bpy)32+ zu reagieren, und das ECL-Signal geht schrittweise zurück. Jedoch stehen aufgrund der Natur des ECL-Abklingens die zwei Reaktionen in Konkurrenz. Das Abklingen der Gesamtreaktion scheint schneller zu sein, verglichen mit den Extinktionsdaten, da weniger NADH-Substrat mit jedem Puls vorhanden ist.

Es wäre gerätetechnisch bedingt, wenn die Geschwindigkeit des ECL-Abklingens verringert wäre, so dass die gemessene Nettowirkung aufgrund der enzymatischen Reaktion wäre. Für diese Wirkung wurden die Parameter des Pulses und die Konzentrationen von NADH und Ru(bpy)32+ gewählt, um ein stabileres ECL-Signal bereit zu stellen. Das Ergebnis war ein sehr stetiges ECL-Ausgangssignal über eine Zeitdauer von drei Minuten.

Der normale klinische Bereich von LDH im Serum beträgt 100 bis 200 U/l, was äquivalent zu 1 bis 2 nM des Enzyms ist, bezogen auf eine Berechnung der Aktivität des Enzyms. Diese Werte liegen genau im Testbereich und demgemäß kann der Test zur Bestimmung von LDH für klinische Verwendungen verwendet werden.

BEISPIEL 4 Streptavidin-biotinylierte DNA.

Das Messverfahren ist sehr ähnlich zu dem, welches zum Messen von NADH- und Enzymkinetikreaktionen, wie vorstehend erörtert, verwendet wurde. Bei den NADH/Enzym-Versuchen ist die Reaktionsgeschwindigkeit sehr hoch, deshalb muss die Probe, kurz bevor der Lauf beginnt, schnell angesaugt werden. Jedoch für die Antikörper-Antigen-Messungen wird eine viel längere Reaktionszeit erwartet und der Versuch muss etwas unterschiedlich aufgebaut werden.

Das Softwareprogramm, welches das ORIGEN®-Analysegerät steuert, wurde so modifiziert, dass ein kontinuierlicher Fluss von Antikörper über die Antigen-markierten Kügelchen an der Elektrodenoberfläche gezogen werden konnte. Das Gerät wurde programmiert, um die Reaktion in einem Aufbau von zwei Röhrchen laufen zu lassen. Die Antigen-markierten Kügelchen wurden aus einem ersten Röhrchen gezogen und an der Elektrode mit dem Magneten eingefangen. Das Karussell wurde inkrementiert und die Antikörper-Markierungs-Lösung (die in Bezug auf die Konzentration im Wesentlichen im Überschuss war) wurde aus dem zweiten Röhrchen über die Kügelchen an der Elektrodenoberfläche gezogen und die Bindungsreaktion begann.

In ähnlicher Weise wie beim NADH/Enzymkinetik-Verfahren wurde entschieden, eine Pulsvariation der Stufenpotentialspannungswellenform bei diesen Versuchen zu verwenden, so dass mehrfache Pulse über ein ausgedehntes Zeitintervall erzeugt wurden, wobei ein Programmspeicher eingebracht war, um nach jedem Puls, der erzeugt wurde, die verstrichene Zeit im Auge zu behalten.

Wenn die sich wiederholende Pulswellenform verwendet wird, können mehrere Parameter für die besondere Reaktion, die gemessen wird, optimiert werden und diese können einfach vom Fachmann auf der Basis der Anleitung, die durch die vorliegende Beschreibung bereitgestellt wird, bestimmt werden. Die Parameter schließen die Anzahl der Pulse, die Pulsbreite, die Wartezeit zwischen Pulsen, die Stufenpotentialspannung und das Restpotential ein.

Das Messverfahren war sehr ähnlich zu dem, welches zur Messung von NADH- und Enzymkinetikreaktionen verwendet wurde. Drei getrennte Reaktionen ließ man laufen und jede verwendete zwei Röhrchen, wie vorstehend angegeben. Bei der Vorbereitung des Versuchs versahen wir 280 Magnetkügelchen mit Streptavidin, gaben sie in ein erstes Röhrchen und gaben dann eine biotinylierte DNA-Markierung dazu. Ein biotinylierter DNA-markierter Kalibrator wurde in ein zweites Röhrchen gegeben.

Unter Verwendung der in dieser Beschreibung definierten Ausdrücke wurden die Reaktionen wie nachstehend beschrieben durchgeführt:

Fortschreitende Reaktion – Wenn der Messzyklus begonnen hatte, veränderte sich die Konzentration über die Zeit, wenn eine Bindung stattfand und die Reaktion zum Abschluss kam.

  • Röhrchen 1: mit Streptavidin versehene Kügelchen.
  • Röhrchen 2: biotinylierter DNA-markierter Kalibrator.

Abgeschlossene Reaktion – Man ließ die Reaktion vorher bis zum Abschluss reagieren, so dass die Intensitätsmessungen nur ein Ergebnis des ECL-Abklingens waren.

  • Röhrchen 1: mit Strepavidin versehene Kügelchen, kombiniert mit biotinylierter DNA-Markierung und mit vollständigem Bindenlassen.
  • Röhrchen 2: biotinylierter DNA-markierter Kalibrator.

Hintergrundreaktion – Es waren keine Kügelchen vorhanden, deshalb war das erzeugte Signal nur ein Ergebnis der Markierung (Hintergrund).

  • Röhrchen 1: Testpuffer (keine Kügelchen zum Binden vorhanden).
  • Röhrchen 2: biotinylierter DNA-markierter Kalibrator.

Nachdem die drei Reaktionen gelaufen waren, wurde unter Verwendung der folgenden Formel die normalisierte Reaktionskurve erhalten:

wie vorstehend erklärt.

Dann ließ man einen zeitlichen Verlauf Röhrchen für Röhrchen unter Verwendung von zwanzig Röhrchen mit Kügelchen und Markierung in den gleichen Konzentrationen, wie vorstehend verwendet, laufen. Sie wurden pipettiert und er Lauf wurde sofort gestartet. Deshalb fand die Bindungsreaktion in jedem Röhrchen statt und die Zeit bis zum Abschluss konnte bestimmt werden, wenn die Kurve (ECL-Intensität gegen Zeit) in ein Plateau mündete. Gemäß diesem zeitlichen Verlauf war die Reaktion in etwa 6 Minuten abgeschlossen. Dies war eine viel kürzere Abschlusszeit, als die, die beim 3-Schritt-Verfahren des zeitlichen Verlaufs erhalten wurde.

Zu diesem Zeitpunkt wurde vermutet, dass die Streptavidin-Biotin-Reaktion durch Diffusion eingeschränkt ist, wenn das 3-Schritt-Verfahren verwendet wird. Um mehr Unterstützung für diese Folgerung zu erhalten, wurde eine Halbwertszeituntersuchung unter Verwendung des 3-Schritt-Verfahrens des zeitlichen Verlaufs durchgeführt.

Das 3-Schritt-Verfahren des zeitlichen Verlaufs wurde unter Verwendung von 6 unterschiedlichen Konzentrationen von Kügelchen wiederholt: 20 &mgr;g, 4 &mgr;g, 2 &mgr;g, 1,3 &mgr;g, 1,0 &mgr;g und 0,8 &mgr;g (pro 300 &mgr;l). Es wurde erwartet, dass, wenn die Kügelchenkonzentration erniedrigt wird, die Reaktion viel schneller abgeschlossen sein wird.

Darauf folgend wurde die Halbwertszeit von jeder Konzentration erhalten. Da die Markierung im Wesentlichen im Überschuss vorhanden war, wurde die Reaktion veranlasst, einer Kinetik von pseudo-erster Ordnung zu folgen. Bei einer Reaktion erster Ordnung ist die Halbwertzeit („t½") unabhängig von der Konzentration und ist definiert als:

t½ = 0,693/k

wobei k die Bindungskonstante ist. Deshalb sollte die Halbwertszeit ungeachtet der Konzentration konstant sein, wenn die Reaktion erster Ordnung ist. In einer Aufzeichnung der Kügelchenkonzentration gegen die Halbwertszeit, wobei der t½-Wert bei 0,5 Minuten genommen wurde, unter der Annahme, dass alle normalisierten Reaktionen bei einem relativen Wert von 1,0 in einem Plateau verharren sollten, nahm die Halbwertszeit ständig ab, wenn die Konzentration abnahm. Die Ergebnisse sind nachstehend zusammengefasst: Kügelchenkonzentration Halbwertszeit (&mgr;g) (Minuten) 0,8 7,5 1,0 8 1,3 10 2 12 4 16 20 35

Diese ständige Abnahme beim t½-Wert ist ein Hinweis, dass das Streptavidin-Biotin-System an der Elektrodenoberfläche durch den Massentransfer eingeschränkt ist. Dies erklärt, warum die Reaktion viel länger braucht, um vollständig abzulaufen, wenn das 3-Schritt-Verfahren gegenüber dem Verfahren Röhrchen-für-Röhrchen verwendet wird.

Obwohl die Streptavidin-Biotin-Reaktion durch Diffusion eingeschränkt war, sollte das 3-Schritt-ECL-Messverfahren des zeitlichen Verlaufs bei einem System, bei welchem die Bindungsgeschwindigkeiten im Wesentlichen niedriger und deshalb nicht durch Diffusion eingeschränkt sind, durchführbar sein.

BEISPIEL 5 Das CEA-Antikörper-Antigen-Sysytem.

Das bei diesen Versuchen verwendete CEA-Testformat bestand aus mit Streptavidin versehenen Kügelchen, die an ein biotinyliertes CEA-Antigen gebunden waren, das darauf folgend an einen spezifischen markierten CEA-Antikörper band. Die Reaktionsgeschwindigkeit, die bei diesem System gemessen wird, ist nicht die Streptavidin-Biotin-Reaktion, sondern die CEA-Antikörper-Antigen-Reaktion.

Ein CEA-Antikörper, der als 1F3 bezeichnet wird, wurde erhalten und das 3-Schritt-ECL-Verfahren des zeitlichen Verlaufs wurde bei diesem System versucht, um mit Werten zu vergleichen, die früher am BIAcore-System unter Verwendung des gleichen 1F3-Antikörpers erhalten wurden. (Das BIAcore-System verwendet Oberflächenplasmonresonanz und es ist von Pharmacia Biosensor AB erhältlich.)

Die höchste Konzentration an 1F3-Markierung, die zum Laufenlassen unter Verwendung des 3-Schritt-Verfahrens gewählt wurde, betrug 11 nM, was mit der Konzentration des Laufs mit der niedrigen Endkonzentration von 10 nM am BIAcore vergleichbar ist. Zusätzlich ließ man zwei niedrigere Konzentrationen von 5,5 nM und 2,7 nM laufen. Das normalisierte Profil, das von der 11 nM 1F3-Markierungs-Lösung erhalten wurde, hatte die gewünschte Gestalt, jedoch wies es ein sehr hohes Rauschen auf. Dies ist wegen der Verwendung des ECL-Verfahrens, wie beschriebenen, wobei sowohl die Markierung, die an die Kügelchen bindet, als auch die freie Markierung, die nicht bindet, (was als Hintergrundsignal betrachtet wird) gleichzeitig an der Elektrodenoberfläche vorhanden sind. Bei hohen Konzentrationen an Markierung wird es schwierig, zwischen den gebundenen und den nicht gebundenen Phasen zu unterscheiden, wobei folglich kein glattes normalisiertes Reaktionsprofil erhalten werden kann. Die normalisierten Profile für die Konzentrationen 5,5 nM und 2,7 nM an 1F3-Antikörper waren viel glatter, was wieder unterstützt, wie der Beitrag der nicht gebundenen Markierung an der Elektrode den Umfang des Rauschens bei dem Signal beeinflussen kann. Da die Konzentration an nicht gebundener Markierung, die an der Elektrode vorhanden ist, niedrig ist, ist es viel einfacher, das Signal der gebundenen Phase zu unterscheiden, und ein viel glätteres Profil wird erhalten.

Beim BIAcore-System ließ man eine Serie von 1F3-Markierungs-Konzentrationen, die im Bereich von 10 nM bis 500 nM lagen, laufen. Das aktuelle 3-Schritt-Verfahren an dem ECL-System ermöglicht keine Markierungskonzentrationen von viel höher als 10 nM.

Um einen Vergleich des 3-Schritt-ECL-Verfahrens mit dem BIAcore-Verfahren zu erhalten, wurde eine mathematische Analyse mit den Daten, die aus den drei normalisierten Konzentrationskurven erhalten wurden, durchgeführt, um die experimentelle Assoziationsgeschwindigkeitskonstante ka abzuleiten. Der ka Wert für die von dem BIAcore erhaltenen Daten war 4,0 × 105 M–1sec–1. Für die ECL-Daten wurde ein mittlerer (± SD) ka-Wert von 9,0 × 105 (± 4,7 × 105) M–1sec–1 erhalten. Dieser Wert ist ein Mittelwert der drei ka-Werte für jede Konzentration.


Anspruch[de]
  1. Verfahren zur Durchführung einer Bestimmung des zeitlichen Verlaufes einer biomolekularen oder enzymatischen Reaktion in einer Zusammensetzung, enthaltend einen Luminophor, einen Reaktanden und einen Reaktionspartner, das Verfahren umfassend die Schritte:

    a) Exponieren der Zusammensetzung an eine Serie von Pulsen elektrischer Energie zu ausgewählten Zeitintervallen, wobei die Pulse von ausreichender Größe sind, um den Luminophor zur Emission eines Elektrochemilumineszenzsignals zu induzieren, wodurch eine Serie von Elektrochemilumineszenzpeaks erzeugt wird, die den einzelnen Pulsen entsprechen;

    b) Messen des Elektrochemilumineszenzsignals zu den gewählten Zeitintervallen;

    c) Korrelieren des bei jedem der Vielzahl gewählter Zeitintervalle gemessenen Elektrochemilumeszenzsignals mit der jeweiligen Konzentration einer Komponente, ausgewählt unter dem Reaktanden, dem Reaktionspartner und dem Reaktionsprodukt, zu jedem der Vielzahl der gewählten Zeitintervalle, um den zeitlichen Verlauf der biomolekularen oder enzymatischen Reaktion zu bestimmen, und

    d) Ausführen der Bestimmung auf Basis der Korrelation.
  2. Verfahren nach Anspruch 1, umfassend:

    a) Ausbilden der Zusammensetzung, enthaltend den Luminophor und den Reaktanden, zur Bildung des Reaktionsproduktes reagiert, und

    b) Exponieren der Zusammensetzung an elektrische Energie zu den gewählten Zeitintervallen und das Messen des Elektrochemilumineszenzsignals an der Vielzahl gewählter Zeitintervalle, um den zeitlichen Verlauf der Reaktion zu bestimmen,

    worin die Intensität des Elektrochemilumineszenzsignals von der Konzentration des Reaktanden oder des Reaktionsprodukts abhängt.
  3. Verfahren nach Anspruch 2, worin die Zusammensetzung den Reaktanden und den Reaktionspartner umfasst und worin der Reaktand und der Reaktionspartner zur Bildung des Reaktionsprodukts reagieren.
  4. Verfahren nach einem der vorstehenden Ansprüche, worin das Verfahren zur Durchführung der Bestimmung des zeitlichen Verlaufs einer Bindungsreaktion ist, umfassend:

    a) Bilden der Zusammensetzung, enthaltend den Luminophor, den Reaktanden und den Reaktionspartner, worin

    (i) der Reaktand und der Reaktionspartner zur Bildung eines Komplexes binden,

    (ii) der Luminophor zur Emission eines Elektrochemilumineszenzsignals induziert werden kann und

    (iii) der Luminophor an den Reaktanden gebunden ist,

    b) Exponieren der Zusammensetzung an elektrische Energie zu den gewählten Zeitintervallen und Messens des Elektrochemilumineszenzsignals zu der Vielzahl von Zeitintervallen, um den zeitlichen Verlauf der Bindungsreaktionen zu bestimmen.
  5. Verfahren nach einem der Ansprüche 1 bis 4, worin das V erfahren zur Durchführung der Bestimmung des zeitlichen Verlaufs einer enzymatischen Reaktion ist, das Verfahren umfassend:

    a) Bilden der Zusammensetzung, enthaltend den Luminophor, den Reaktanden, den Reaktionspartner und ein Enzym, wobei der Reaktand ein Substrat für das Enzym ist, worin

    i) das Enzym die Reaktion des Substrats zur Bildung des Reaktionsproduktes katalysiert,

    ii) der Luminophor zur Emission eines Elektrochemilumineszenzsignals induziert werden kann und das von dem Luminophor emittierte Elektrochemilumineszenzsignal mit der Konzentration des Substrates oder des Reaktionsproduktes variiert und

    iii) die Intensität des Elektrochemilumineszenzsignals, das bei Exposition der Zusammensetzung an elektrische Energie emittiert wird, sich mit dem Fortschreiten der Reaktion ändert,

    b) Exponieren der Zusammensetzung an elektrische Energie zu den gewählten Zeitintervallen und Messen des Elektrochemilumineszenzsignals an der Vielzahl gewählter Zeitintervalle, um den zeitlichen Verlauf der Reaktion zu bestimmen.
  6. Verfahren nach einem der Ansprüche 1 bis 5, zusätzlich umfassend das Normalisieren des Elektrochemilumineszenzsignals.
  7. Verfahren nach Anspruch 6, worin das Normalisieren die Herstellung einer zweiten Reaktionsmischung mit den Komponenten der Zusammensetzung, das Reagierenlassen bis zum Abschluss, das Exponieren der zweiten Reaktionsmischung an elektrische Energie und das Messen der emititerten Elektrochemilumineszenz umfasst.
  8. Verfahren nach den Ansprüchen 2 bis 6, worin das Normalisieren das Herstellen einer Reaktionsmischungskontrolle, umfassend den Luminophor und den Reaktanden, jedoch unter Bedingungen, bei denen die Reaktion nicht abläuft, das Exponieren der Reaktionskontrollmischung an elektrische Energie und das Messen der emittierten Elektrochemilumineszenz umfasst.
  9. Verfahren nach den Ansprüchen 3 bis 5, weiterhin umfassend:

    c) das Bilden einer zweiten Reaktionsmischung mit den in der Zusammensetzung enthaltenen Komponenten,

    d) das Reagierenlassen der zweiten Reaktionsmischung solange, bis die Reaktion abgeschlossen ist, und anschließendes Exponieren der zweiten Reaktionsmischung an elektrische Energie zu den gewählten Zeitintervallen, wie in Schritt (b) durchgeführt, und das Messen der Elektrochemilumineszenz an den gewählten Zeitintervallen, wie es in Schritt (d) durchgeführt, um einen Wert für jedes Intervall zu erhalten;

    e) das Bilden einer dritten Reaktionsmischung mit den in der Zusammensetzung enthaltenen Komponenten, mit der Ausnahme, dass diese den Reaktionspartner nicht enthält,

    f) Exponieren der dritten Reaktandenmischung an elektrische Energie zu den gewählten Zeitintervallen, wie in Schritt (b) durchgeführt, und das Messen der Elektrochemilumineszenz zu den gewählten Zeitintervallen, wie in Schritt (b) durchgeführt, um einen Wert für jedes Intervall zu erhalten;

    g) das Subtrahieren des Wertes, der für das erste Intervall in Schritt (f) erhalten wird, von dem Wert, der für das erste Intervall in Schritt (b) erhalten wird, um eine erste Differenz zu erhalten;

    h) das Subtrahieren des Wertes, der für das erste Intervall in Schritt (f) erhalten wird, von dem Wert, der für das erste Intervall in Schritt (d) erhalten wird, um eine zweite Differenz zu erhalten,

    i) das Teilen der ersten Differenz durch die zweite Differenz, um einen normalisierten Wert für das erste Intervall zu erhalten;

    j) das Wiederholen der Schritte (g), (h) und (i) für jedes folgende Intervall, um einen normalisierten Wert für jedes folgende Intervall zur erhalten, und

    k) die Durchführung der Bestimmung des zeitlichen Verlaufes der Reaktion aus den normalisierten Werten aller Intervalle.
  10. Verfahren gemäß einem der Ansprüche 1 bis 9, worin die Pulse von gewählter Dauer sind.
  11. Verfahren nach einem der Ansprüche 2 bis 5, zusätzlich umfassend den Schritt des Bestimmens der Konzentration des Reaktanden in einer Probe.
  12. Verfahren nach den Ansprüchen 2 bis 5, worin der Luminophor mit dem Reaktanden oder dem Reaktionsprodukt partizipiert, um bei Exposition an elektrische Energie Elektrochemilumineszenz zu imitieren.
  13. Verfahren nach Anspruch 4, worin der Komplex ein Antikörper/Antigen-Komplex ist.
  14. Verfahren nach Anspruch 3 oder 4, worin der Reaktand an den Luminophor gebunden ist und der Reaktionspartner an ein Magnetkügelchen gebunden ist.
  15. Verfahren nach Anspruch 5, worin das Substrat ein Co-Faktor ist.
  16. Verfahren nach Anspruch 5, worin der Reaktionspartner ein Co-Faktor ist.
  17. Verfahren nach den Ansprüchen 15 oder 16, worin der Co-Faktor NADH ist.
  18. Verfahren nach einem der Ansprüche 1 bis 17, worin der Luminophor einen organischen Luminophor umfasst.
  19. Verfahren nach einem der Ansprüche 1 bis 17, worin der Luminophor einen organometallischen Luminophor umfasst.
  20. Verfahren nach Anspruch 19, worin der Luminophor ausgewählt ist aus der Gruppe, bestehend aus Ru-enthaltenden und Os-enthaltenden Verbindungen.
  21. Verfahren nach Anspruch 20, worin der Luminophor Rutheniumtrisbipyridin oder Osmiumtrisbipyridin ist.
Es folgt kein Blatt Zeichnungen






IPC
A Täglicher Lebensbedarf
B Arbeitsverfahren; Transportieren
C Chemie; Hüttenwesen
D Textilien; Papier
E Bauwesen; Erdbohren; Bergbau
F Maschinenbau; Beleuchtung; Heizung; Waffen; Sprengen
G Physik
H Elektrotechnik

Anmelder
Datum

Patentrecherche

Patent Zeichnungen (PDF)

Copyright © 2008 Patent-De Alle Rechte vorbehalten. eMail: info@patent-de.com