PatentDe  


Dokumentenidentifikation DE69535075T2 04.01.2007
EP-Veröffentlichungsnummer 0000778888
Titel ANTIGEN-MARKIERTE NICHT-INFEKTIÖSE RETROVIRUS-ÄHNLIGE PARTIKEL
Anmelder Sanofi Pasteur Ltd., Toronto, Ontario, CA
Erfinder ROVINSKI, Benjamin, Thornhill, Ontario L4J 5H6, CA;
CAO, Shi-Xian, Etobicoke, Ontario M9C 4X6, CA;
YAO, Fei-long, North York, Ontario M2J 4H8, CA;
PERSSON, Roy, North York, Ontario M2M 4J4, CA;
KLEIN, Michel H., Willowdale, Ontario M2P 1B9, CA
Vertreter WUESTHOFF & WUESTHOFF Patent- und Rechtsanwälte, 81541 München
DE-Aktenzeichen 69535075
Vertragsstaaten AT, BE, CH, DE, DK, ES, FR, GB, GR, IE, IT, LI, LU, MC, NL, PT, SE
Sprache des Dokument EN
EP-Anmeldetag 15.08.1995
EP-Aktenzeichen 959276114
WO-Anmeldetag 15.08.1995
PCT-Aktenzeichen PCT/CA95/00483
WO-Veröffentlichungsnummer 1996005292
WO-Veröffentlichungsdatum 22.02.1996
EP-Offenlegungsdatum 18.06.1997
EP date of grant 21.06.2006
Veröffentlichungstag im Patentblatt 04.01.2007
IPC-Hauptklasse C12N 7/00(2006.01)A, F, I, 20051017, B, H, EP
IPC-Nebenklasse C12N 15/62(2006.01)A, L, I, 20051017, B, H, EP   C12N 15/85(2006.01)A, L, I, 20051017, B, H, EP   C07K 14/08(2006.01)A, L, I, 20051017, B, H, EP   C07K 14/11(2006.01)A, L, I, 20051017, B, H, EP   C07K 14/16(2006.01)A, L, I, 20051017, B, H, EP   C12Q 1/68(2006.01)A, L, I, 20051017, B, H, EP   G01N 33/53(2006.01)A, L, I, 20051017, B, H, EP   G01N 33/577(2006.01)A, L, I, 20051017, B, H, EP   A61K 39/12(2006.01)A, L, I, 20051017, B, H, EP   A61K 39/21(2006.01)A, L, I, 20051017, B, H, EP   

Beschreibung[de]
GEBIET DER ERFINDUNG

Diese Erfindung betrifft das Gebiet der Immunologie und beschäftigt sich insbesondere mit antigenisch markierten nicht-infektiösen, Retrovirus-ähnlichen Partikeln (die manchmal als Pseudovirionen bezeichnet werden).

HINTERGRUND DER ERFINDUNG

Humanes Immundefizienzvirus ist ein humanes Retrovirus und ist das ätiologische Agens von erworbenem Immundefizienzsyndrom (AIDS). Seit AIDS erstmalig 1981 in den USA berichtet wurde, sind mehr als 194000 Menschen an AIDS verstorben, und über 330 000 Fälle von HIV-Infektion wurden allein in den USA berichtet. Es wird geschätzt, dass weltweit mehr als 14 Millionen Menschen mit HIV infiziert worden sind.

Mehr als 100 mit AIDS zusammenhängede Arzneimittel befinden sich in klinischen Versuchen am Menschen oder warten auf die Zulassung durch die FDA, aber derzeit gibt es keine Heilung für die Krankheit.

Deshalb besteht ein klarer Bedarf nach immungenen Präparaten, welche als Impfstoffkandidaten, als Antigene in diagnostischen Assays und Kits und für die Erzeugung von immunologischen Reagenzien zur Diagnose von HIV und sonstigen retroviralen Erkrankungen und Infektionen nützlich sind.

Einzelne immunogene Präparate des Stands der Technik schließen nicht-infektiöse, nicht-replizierende HIV-ähnliche Partikel ein. Die PCT-Anmeldungen WO 93/20220, veröffentlicht am 14. Oktober 1993, und WO 91/05860, veröffentlicht am 2. Mai 1990 (Whitehead Institute for Biomedical Research), lehren somit Konstrukte, welche HIV-Genome umfassen, die eine Veränderung in einer Nukleotidsequenz aufweisen, welche kritisch für die genomische RNA-Packung ist, und die Herstellung von nicht-infektiösen immunogenen HIV-Partikeln, welche durch Expression dieser Konstrukte in Säugerzellen erzeugt werden.

Die PCT-Anmeldung WO 91/07425, welche am 30. Mai 1991 veröffentlicht wurde (Oncogen Limited Partnership), lehrt nicht-replizierende retrovirale Partikel, die durch Coexpression von reifen retroviralen Kern- und Hüll-Strukturproteinen hergestellt werden, so dass sich die exprimierten retroviralen Proteine zu knospenden retroviralen Partikeln zusammenfügen. Ein besonderes nicht-replizierendes HIV-1-ähnliches Partikel wurde durch Co-Infizieren von Säugerwirtszellen mit einem rekombinanten Vaccinia-Virus, welches die gag- und Protease-Gene von HIV-1 trug, und einem rekombinanten Vaccinia-Virus, welches das HIV-1-env-Gen trug, hergestellt.

In der veröffentlichten PCT-Anmeldung WO 91/05864, im Namen das Patentinhabers hiervon, werden besondere nicht-infektiöse, nicht-replizierende Retrovirus-ähnliche Partikel beschrieben, enthaltend wenigstens gag-, pol- und env-Proteine in ihrer natürlichen Konformation, und codiert von einem modifizierten retroviralen Genom, welches hinsichtlich Long-Terminal-Repeats bzw. langer terminaler Wiederholungseinheiten defizient ist und gag-, pol- und env-Gene in ihrer natürlichen genomischen Anordnung enthält.

Da es keinen Impfstoff noch eine wirksame Behandlung für AIDS gibt und da derartige HIV-ähnliche Partikel nach dem Stand der Technik viele der HIV-Proteine in ihren natürlichen Konformationen enthalten, kann ein damit immunisierter Wirt eine Immunantwort hervorbringen, welche immunologisch nicht von einer Infektion durch HIV unterscheidbar ist. Hitzeinaktiviertes Anti-HIV-Antiserum, erhalten aus HIV-infizierten Menschen, und inaktiviertes HIV sind derzeitig kommerziell als Komponenten vieler diagnostischer Verfahren erhältlich. Für die Sicherheit, Einfachheit der Handhabung, Transport, Aufbewahrung und Anwendung kann es bevorzugt sein, derartige hitzeinaktivierten Antiseren und Antigene durch nicht-infektiöses HIV und Antiseren, welche erzeugt werden durch Immunisierung mit nicht-infektiösen HIV-Partikeln, wie oben beschrieben, zu ersetzen. Darüber hinaus erfordern Antiseren, erzeugt durch Immunisierung mit diesen nicht-infektiösen HIV-Partikeln, keine Hitzeinaktivierung, um infektiöses HIV zu entfernen. Allerdings ist es wegen der Schwere einer HIV-Infektion wünschenswert, in der Lage zu sein, zwischen inaktiviertem HIV und nicht-infektiösen, nicht-replizierenden HIV-Partikeln sowie Antiseren, welche durch virulente HIV- und nicht-infektiöse, nicht-replizierende HIV-Partikel erzeugt werden, zu unterscheiden. Somit wäre es in der Entwicklung von AIDS-Impfstoffkandidaten, immunogenen Präparaten und diagnostischen Verfahren und Kits nützlich, ein HIV-ähnliches Partikel vorzusehen, welches immunologisch oder anderweitig von virulentem HIV unterscheidbar ist.

ZUSAMMENFASSUNG DER ERFINDUNG

Die vorliegende Erfindung betrifft die Fähigkeit, zwischen einer Infektion durch HIV oder einem anderen Retrovirus, insbesondere einem humanen Retrovirus, und einer Immunisierung mit einer immunogenen Präparation zu unterscheiden. Die Erfindung beschäftigt sich auch mit der Fähigkeit, zwischen inaktivierten virulenten HIV- und nicht-infektiösen, nicht-replizierenden HIV-ähnlichen Partikeln zu unterscheiden. Die vorliegende Erfindung bindet einen Marker in ein nicht-infektiöses, Retrovirus-ähnliches Partikel ein.

Folglich sieht die vorliegende Erfindung, in einem Aspekt, ein nicht-infektiöses humanes Immundefizienz-Virus(HIV)-ähnliches Partikel vor, welches eine Baugruppe aus folgendem umfasst: (a) ein env-Genprodukt; (b) ein pol-Genprodukt; (c) ein gag-Genprodukt; und (d) mindestens einen antigenen Marker, welcher nicht-HIV-retroviral ist und nicht-retroviral sein kann und in der Lage ist, eine Immunantwort hervorzurufen.

Der mindestens eine antigene Marker kann etwa 5 bis etwa 100 Aminosäurereste, insbesondere etwa 10 bis etwa 75 Aminosäurereste aufweisen. Der antigene Marker kann mindestens ein antigenes Epitop aus einem anderen Virus umfassen. Die Erfindung wird, in einer Ausführungsform, durch mindestens ein antigenes Epitop aus Tabak-Mosaik-Virus(TMV)-Hüllprotein veranschaulicht, das spezifisch eine Aminosäuresequenz AFDTRNRIIEVEN (SEQ. ID. Nr.: 1) oder einen Abschnitt, eine Variation oder Mutante davon, fähig zur Hervorrufung von Antikörpern, welche diese Sequenz erkennen, oder mehrere Kopien, spezifisch 1 bis 4, einer derartigen Aminosäure-Sequenz, einschließt.

Der antigene Marker kann in die Baugruppe von env-, pol- und gag-Genprodukten in jeder zweckmäßigen Weise eingebunden werden. In einer Ausführungsform der Erfindung ist die Markersequenz innerhalb des gag-Genprodukts enthalten, wodurch ein hybrides gag-Genprodukt gebildet wird, aufweisend die Partikel-Bildungsmerkmale von unmodifiziertem gag-Genprodukt. Die Markersequenz kann innerhalb des gag-Genprodukts durch Insertion des antigenen Markers in das gag-Genprodukt an einer antigenisch aktiven Insertionsstelle enthalten sein.

In einer spezifischen Ausführungsform der Erfindung kann die Insertionsstelle diejenige sein, welche zwischen den Aminosäureresten 210 und 211 des gag-Genprodukts des HIV-1-LAI-Isolates oder der entsprechenden Stelle von anderen retroviralen gag-Genprodukten lokalisiert ist.

Die Markersequenz kann auch durch Deletieren oder Verhindern der Herstellung einer Aminosäuresequenz, welche einem Epitop eines retroviralen Proteins entspricht, vorgesehen werden. Zum Beispiel kann ein solches Epitop eine immundominante Region, gp41, umfassen, welche eine endogene Verankerungsfunktion bereitstellt. Wenn eine derartige endogene Verankerungsfunktion auf diese Weise entfernt wird, wird die Verankerungsfunktion von einer unterschiedlichen antigenen Ankersequenz bereitgestellt. Alternativ dazu kann die immundominante Region des env-Genprodukts durch Substitution oder Entfernung von mindestens einer Aminosäure daraus modifiziert werden, um im Wesentlichen eine Erkennung der immundominanten Region in der resultierenden Mutation durch Seren aus mit Retrovirus infizierten Wirten zu verhindern.

In dieser Ausführungsform der Erfindung kann das Retrovirus HIV-1 sein, und die immundominante Region kann die Aminosäuresequenz LGIWGCSGKLIC (SEQ. ID. Nr.: 27) enthalten. Spezifische Aminosäuresequenzen von Mutationen, welche hierin bereitgestellt werden können, schließen LGIWGCTGRKILC (SEQ. ID. Nr.: 28), LGIWGCAFRLIC (SEQ. ID. Nr.: 29) und LGIWGCTLELIC (SEQ. ID. Nr.: 30) ein.

Folglich wird, in einem anderen Aspekt der vorliegenden Erfindung, ein nicht-infektiöses Retrovirus-ähnliches Partikel bereitgestellt, umfassend eine Baugruppe von (a) einem modifizierten env-Genprodukt, in welchem die endogene Verankerungsfunktion durch eine unterschiedliche Ankersequenz, welche funktionsfähig an das env-Genprodukt geknüpft ist, ersetzt worden ist, um das env-Genprodukt an dem Retrovirus-ähnlichen Partikel zu verankern; (b) ein pol-Genprodukt; und (c) ein gag-Genprodukt.

Die Ankersequenz, welche antigenisch sein kann, kann zwischen etwa 5 und etwa 100 Aminosäureresten, vorzugsweise etwa 10 bis etwa 75 Aminosäureresten, aufweisen. Die Ankersequenz kann wenigstens einen Teil einer Transmembrankomponente eines Membranüberspannenden Proteins, insbesondere eines Glykoproteins, umfassen. Ein derartiges Glykoprotein kann jedwedes zweckmäßige Glykoprotein, wie ein Influenzavirus-Protein, insbesondere ein Human-Influenzavirus-Protein, oder ein Vogel-Influenzavirus-Protein, sein.

Die Ankersequenz kann eine Aminosäuresequenz WILWISFAISCFLLCVVLLGFIMW (SEQ. ID. Nr.: 2) oder eine Portion, Variation oder Mutante davon, fähig zur Hervorrufung von Antikörpern, welche dieses Sequenz erkennen, eine Aminosäure-Sequenz STVASSLALAIMIAGLSFWMCSNGSLQ (SEQ. ID. Nr.: 3) oder eine Portion, Variation oder Mutante davon, fähig zur Hervorrufung von Antikörpern, welche diese Sequenz erkennen; oder eine Aminosäure-Sequenz WILWISFAISCFLLCVVCWGSSCGPAKKATLGATFAFDSKEEWCREKKEQWE (SEQ. ID. Nr.: 4) oder eine Portion, Variation oder Mutante davon, fähig zur Hervorrufung von Antikörpern, welche diese Sequenz erkennen, einschließen.

Die Ankersequenz wird vorzugsweise in das env-Genprodukt, benachbart zu und stromaufwärts von funktionellen Spaltungsstellen des env-Genprodukts inseriert. Die Insertionsstelle liegt vorzugsweise zwischen den Aminosäureresten 507 und 508 des env-Genprodukts des HIV-1-LAI-Isolates oder der entsprechenden Stelle von anderen retroviralen env-Genprodukten.

Das Retrovirus-ähnliche Partikel, welches gemäß einem der Aspekte der Erfindung bereitgestellt wird, ist vorzugsweise ein solches, in welchem die env-, pol- und gag-Genprodukte den env-, pol- und gag-Genprodukten eines humanen Retrovirus, insbesondere HIV-1 oder HIV-2, entsprechen.

Spezifisch kann das humane Retrovirus HIV-1 sein, und das env-Genprodukt kann ein LAI-env-Genprodukt, ein MN-env-Genprodukt, ein env-Genprodukt aus einem primären HIV-1-Isolat oder ein env-Genprodukt, welches antigenisch dazu äquivalent ist, sein. Die gag- und pol-Genprodukte können aus einem HIV-1-Isolat abgeleitet werden, welches verschieden von dem HIV-1-Isolat ist, aus welchem das env-Genprodukt abgeleitet wird. Insbesondere kann, in solchen Partikeln, das env-Genprodukt aus einem primären HIV-1-Isolat abgeleitet sein.

Die vorliegende Erfindung beinhaltet ebenfalls Nukleinsäuremoleküle, welche nicht-infektiöse, Retrovirus-ähnliche Partikel der Erfindung codieren. Folglich wird, in einem anderen Aspekt der Erfindung, ein Nukleinsäuremolekül bereitgestellt, welches ein nicht-infektiöses HIV-ähnliches Partikel codiert, umfassend ein modifiziertes HIV-Genom, das hinsichtlich Long-Terminal-Repeats defizient ist und gag-, pol- und env-Gene in ihrer natürlichen genomischen Anordnung und ein Segment, welches mindestens einen antigenen Marker codiert, der nicht-HIV-retroviral ist und der nicht-retroviral sein kann, enthält. Das Nukleinsäuremolekül kann ein DNA-Molekül umfassen, enthaltend die charakteristischen genetischen Elemente, welche in einem SacI- bis XhoI-Fragment des Genoms des HIV-1LAI-Isolates vorhanden sind. Das modifizierte Genom kann ebenfalls hinsichtlich einer Primer-Bindungsstelle defizient sein.

In einer spezifischen veranschaulichenden Ausführungsform dieses Aspekts der Erfindung wird die Sequenz, welche den mindestens einen antigenen Marker codiert, in das gag-Gen inseriert, spezifisch an der PstI-Stelle am Nukleotid 1415 des gag-Gens des HIV-1-LAI-Isolates oder der entsprechenden Lokalisierung von anderen retroviralen gag-Genen. Ein spezifisches Segment umfasst 1 bis 4 Kopien einer DNA-Sequenz, welche gewählt wird aus der Gruppe, bestehend aus:

  • (a) 5' GCATTCGACACTAGAAATAGAATAATAGAAGTTGAAAAT 3'; (SEQ. ID. Nr.: 5);
  • (b) 3' CGTAAGCTGTGATCTTTATCTTATTATCTTCAACTTTTA 5'; (SEQ. ID. Nr.: 6); und
  • (c) DNA-Sequenzen, welche mit (a) oder (b) unter stringenten Bedingungen hybridisieren, insbesondere Sequenzen, welche mindestens etwa 90% Sequenzidentität mit der Sequenz von (a) oder (b) aufweisen.

Eine Vielzahl von Hybridisierungsbedingungen kann angewandt werden, um verschiedene Ausmaße an Selektivität der Hybridisierung zu erzielen. Für einen hohen Grad an Selektivität werden stringente Bedingungen zum Bilden der Doppelstränge verwendet, wie Niedrigsalz- und/oder Hochtemperatur-Bedingungen, wie sie bereitgestellt werden durch 0,02 M bis 0,15 M NaCl bei Temperaturen zwischen etwa 50°C und 70°C. Für manche Anwendungen werden weniger stringente Hybridisierungsbedingungen gefordert, wie 0,15 M bis 0,9 M Salz bei Temperaturen im Bereich von zwischen etwa 20°C und 55°C. Hybridisierungsbedingungen können auch durch die Zugabe von steigenden Mengen an Formamid stringenter gemacht werden, um den Hybriddoppelstrang zu destabilisieren.

In noch einer weiteren Ausführungsform der vorliegenden Erfindung wird ein Nukleinsäuremolekül bereitgestellt, das ein nicht-infektiöses HIV-ähnliches Partikel codiert, umfassend ein modifiziertes HIV-Genom, welches hinsichtlich Long-Terminal-Repeats defizient ist und gag-, pol- und env-Gene in ihrer natürlichen genomischen Anordnung enthält, wobei das env-Gen modifiziert ist, um darin ein Segment bereitzustellen, codierend eine antigene Ankersequenz zum Verankern des env-Genprodukts an dem Retrovirus-ähnlichen Partikel, wobei das modifizierte env-Gen ein modifiziertes env-Genprodukt codiert, in welchem die endogene Verankerungs-Funktion von env durch die antigene Ankersequenz ersetzt worden ist.

In einer spezifischen veranschaulichenden Ausführungsform dieses Aspekts der Erfindung wird das Segment, welches die antigene Markersequenz codiert, in das env-Gen inseriert, spezifisch zwischen den Nukleotiden 7777 und 7778 des env-Gens des HIV-LAI-Isolates oder der entsprechenden Stelle von anderen retroviralen env-Genen. Ein spezifisches Segment, welches die Ankersequenz codiert, schließt eine DNA-Sequenz ein, ausgewählt aus der Gruppe, bestehend aus:

  • (a) 5' TGGATCCTGTGGATTCCTTTGCCATATCATGCTTTTTGCTTTG TGTTGTTTTGCTGGGGTTCATCATGTGG 3'; (SEQ. ID. Nr.: 7);
  • (b) 3' ACCTAGGACACCTAAAGGAAACGGTATAGTACGAAAAACGAAACACAACAAAACGACCCCAAGTAGTACACC 5'; (SEQ. ID. Nr.: 8); und
  • (c) DNA-Sequenzen, welche mit (a) oder (b) unter stringenten Bedingungen hybridisieren, insbesondere Sequenzen, welche mindestens etwa 90% Sequenzidentität mit den Sequenzen von (a) oder (b) besitzen.

Ein anderes spezifisches Segment, welches die Ankersequenz codiert, schließt eine DNA-Sequenz ein, welche aus der Gruppe gewählt wird, bestehend aus:

  • (a) 5' TCAACAGTGGCAAGTTCCCTAGCACTGGCAATCATGATAGCTGGTCTATCTTTTTGGATGTGTTCCAATGGGTCATTGCAG 3' (SEQ. ID. Nr.: 9);
  • (b) 3' AGTTGTCACCGTTCAAGGGATCGTGACCGTTAGTACTATCGACCAGATAGAAAAACCTACACAAGGTTACCCAGTAACGTC 5' (SEQ. ID. Nr.: 10); und
  • (c) DNA-Sequenzen, welche mit (a) oder (b) unter stringenten Bedingungen hybridisieren, insbesondere Sequenzen, welche mindestens etwa 90% Sequenzidentität mit den Sequenzen von (a) oder (b) besitzen. Ein weiteres spezifisches Segment, welches die Ankersequenz codiert, schließt eine DNA-Sequenz ein, welche aus der Gruppe gewählt ist, bestehend aus:
  • (c) DNA-Sequenzen, welche mit (a) oder (b) unter stringenten Bedingungen hybridisieren, insbesondere Sequenzen, welche mindestens etwa 90% Sequenzidentität mit der Sequenz von (a) oder (b) besitzen.

Die vorliegende Erfindung schließt ferner, in einem zusätzlichen Aspekt, eine immunogene Zusammensetzung ein, fähig zur Hervorrufung einer HIV-spezifischen Immunantwort und einer spezifischen Immunantwort gegen einen nicht-retroviralen Marker, umfassend die Retrovirus-ähnlichen Partikel oder das Nukleinsäuremolekül, welche hierin bereitgestellt werden, und einen Träger dafür. Eine solche Zusammensetzung kann für mukosale oder parenterale Verabreichung, durch orale, anale, vaginale oder intranasale Wege, formuliert werden. Die immunogene Zusammensetzung kann mindestens ein anderes immunologisches oder immunstimulierendes Material, spezifisch ein Adjuvans, wie Aluminiumphosphat, Aluminiumhydroxid, QS21, Quil A, Calciumphosphat, Calciumhydroxid, Zinkhydroxid, ein Glykolipid-Analog, einen Octadecyl-Ester einer Aminosäure, ein Muramyldipeptid, ein Lipoprotein oder Freund'sches unvollständiges Adjuvans, umfassen.

In einem weiteren Aspekt kann die vorliegende Erfindung in einem Verfahren zur Immunisierung eines Wirtes verwendet werden, um eine HIV-spezifische Immunantwort und eine spezifische nicht-retrovirale Immunantwort gegen einen antigenen Marker hervorzubringen, umfassend das Verabreichen einer immunwirksamen Menge der immunogenen Zusammensetzung, welche hierin bereitgestellt wird, an den Wirt.

Die vorliegende Erfindung kann auch in diagnostischen Vorgehensweisen und Kits unter Verwendung dieser Materialien eingesetzt werden.

Spezifisch kann ein Verfahren zur Bestimmung der Gegenwart von Antikörpern bereitgestellt werden, welche spezifisch mit HIV-Antigenen in einer Probe reagieren, umfassend die Schritte des (a) Kontaktierens der Probe mit dem hierin vorgesehenen nicht-infektiösen HIV-ähnlichen Partikel zur Herstellung von Komplexen, umfassend die nicht-infektiösen HIV-ähnlichen Partikel und jedwede derartigen Antikörper, welche in der Probe vorhanden sind, die spezifisch damit reaktiv sind; und (b) des Bestimmens der Erzeugung der Komplexe.

Darüber hinaus kann ein Verfahren zur Bestimmung der Gegenwart von HIV-Antigenen in einer Probe bereitgestellt werden, umfassend die Schritte des (a) Immunisierens eines Wirtes mit der hierin bereitgestellten immunogenen Zusammensetzung zur Hervorrufung von HIV-Antigen-spezifischen Antikörpern; (b) des Kontaktierens der Probe mit den HIV-Antigenspezifischen Antikörpern zur Herstellung von Komplexen, umfassend jedwede HIV-Antigene in der Probe und die HIV-Antigen-spezifischen Antikörper; und (c) des Bestimmens der Erzeugung der Komplexe.

Die Erfindung kann in einem diagnostischen Kit zum Nachweisen der Gegenwart von HIV-Antigenen in einer Probe angewandt werden, umfassend (a) mindestens einen solchen HIV-Antigen-spezifischen Antikörper, wie hierin beschrieben; (b) Mittel zum Kontaktieren des mindestens einen Antikörpers mit der Probe zur Erzeugung eines Komplexes, umfassend jedwede HIV-Antigene in der Probe und die HIV-Antigen-spezifischen Antikörper; und (c) Mittel zum Bestimmen der Erzeugung des Komplexes.

Ferner wird, in einem zusätzlichen Aspekt der Erfindung, ein Verfahren zum Identifizieren von Antiserum bereitgestellt, welches mittels Immunisierung mit der hierin bereitgestellten immunogenen Zusammensetzung erzeugt wird, umfassend das Nachweisen von Antikörpern in dem Antiserum, welche spezifisch für den antigenen Marker sind.

Vorteile der vorliegenden Erfindung schließen folgende ein:

  • – ein immunogenes HIV-ähnliches Partikel, umfassend gag-, pol- und env-Genprodukte in ihren natürlichen Konformationen, welches nicht-infektiös und nicht-replizierend gemacht wurde; und
  • – ein immunogenes HIV-ähnliches Partikel, das immunologisch von einem virulenten Retrovirus unterscheidbar ist.

KURZE BESCHREIBUNG DER ZEICHNUNGEN

Die vorliegende Erfindung wird ferner aus der folgenden Beschreibung unter Bezugnahme auf die Zeichnungen verstanden werden, worin:

die 1 ein Konstruktionsschema eines Plasmids (pMTHIV-A) zeigt, das ein Retrovirusähnliches Partikel gemäß einer Ausführungsform der Erfindung codiert;

die 2 ein Konstruktionsschema eines Plasmids (pMTHIVBRU) zeigt, das ein Retrovirus-ähnliches Partikel gemäß einer weiteren Ausführungsform der Erfindung codiert;

die 3 zeigt ein Konstruktionsschema eines Plasmids (P83-19), das ein Retrovirusähnliches Partikel, gemäß einer weiteren Ausführungsform der Erfindung, codiert;

die 4 zeigt ein Konstruktionsschema eines Plasmids (pSeBS-HA2) gemäß einer Ausführungsform der Erfindung;

die 5 zeigt ein Flussdiagramm für Gen-Assemblierungs-unterstützte Mutagenese;

die 6 zeigt ein Konstruktionsschema eines Plasmids (pMTHIVHA2-701), codierend ein Retrovirus-ähnliches Partikel, enthaltend eine antigene Markersequenz, umfassend einen Teil der Transmembrankomponente von humanem Influenza-Hämagglutinin-Glykoprotein gemäß einer weiteren Ausführungsform der vorliegenden Erfindung;

die 7 zeigt ein Konstruktionsschema eines Plasmids (pMTHIVmHA2), codierend ein Retrovirus-ähnliches Partikel, enthaltend einen nicht-natürlich vorkommenden Marker, gemäß einer weiteren Ausführungsform der Erfindung;

die 8 zeigt ein Konstruktionsschema eines Plasmids (pMTHIVMNmHA2-5), codierend ein Retrovirus-ähnliches Partikel, enthaltend einen nicht-natürlich vorkommenden Marker, gemäß noch einer weiteren Ausführungsform der Erfindung;

die 9 zeigt Details eines Oligonukleotids, welches ein antigenes Epitop aus Tabak-Mosaik-Virus codiert, das in das gag-Genprodukt eines nicht-infektiösen, nicht-replizierenden Retrovirus-ähnlichen Partikels inseriert ist, gemäß einer anderen Ausführungsform der Erfindung;

die 10 zeigt ein Konstruktionsschema von Plasmiden, welche Retrovirus-ähnliche Partikel, die antigene Epitope aus Tabak-Mosaik-Virus aufweisen, codieren;

die 11 zeigt eine Immunoblot-Analyse von antigenisch markierten Retrovirus-ähnlichen Partikeln (Pseudovirionen) der vorliegenden Erfindung; und

die 12 zeigt eine Immunoblot-Analyse von antigenisch markierten Retrovirus-ähnlichen Partikeln, um den Einschluss des antigenen Markers in dem gag-Genprodukt aufzuzeigen;

die 13 zeigt die Immunantwort in Meerschweinchen, welche mit Retrovirus-ähnlichen Partikeln immunisiert wurden, die durch Einschluss der mHA2-Sequenz antigenisch markiert waren;

die 14 zeigt die Immunantwort in Meerschweinchen, welche mit Retrovirus-ähnlichen Partikeln immunisiert wurden, die durch Einschluss der TMV-Marker-Sequenz antigenisch markiert waren;

die 15 zeigt die Lokalisierung einer immundominanten Region im Hüll-Glykoprotein gp120 von HIV-1 zur Modifikation, um ein nicht-infektiöses Retrovirus-ähnliches Partikel vorzusehen, das antigenisch von HIV-1 unterscheidbar ist;

die 16 zeigt eine Immunoblot-Analyse von Retrovirus-ähnlichen Partikeln, enthaltend Hüll-Glykoprotein gp120 von einem klinischen Primärisolat von HIV-1.

ALLGEMEINE BESCHREIBUNG DER ERFINDUNG

Für den Fachmann auf dem Gebiet ist es deutlich offensichtlich, dass die verschiedenen Ausführungsformen der vorliegenden Erfindung viele Anwendungen auf den Gebieten der Impfung, Diagnose, Behandlung von HIV-Infektionen und der Erzeugung von immunologischen Reagenzien aufweisen. Eine weitere nicht-einschränkende Diskussion derartiger Anwendungen wird nachstehend weiter dargestellt.

Unter Bezugnahme auf die 1 und 2 wird die Konstruktion eines Vektors pMTHIVBRU (ATCC-Bezeichnung 75 852) veranschaulicht, welcher ein modifiziertes retrovirales Genom enthält, das hinsichtlich der Long-Terminal-Repeats, Primer-Bindungsstelle und einer RNA-Verpackungssequenz defizient ist und gag-, pol- und env-Gene in ihrer natürlicher genomischen Anordnung enthält. Das pol-Gen von pMTHIVBRU ist durch Deletion eines Bereichs davon modifiziert worden, um seine Reverse-Transkriptase- und Integrase-Aktivitäten im Wesentlichen zu entfernen. Weiterhin ist, in dieser besonderen veranschaulichten Ausführungsform der Erfindung, ein Oligonukleotid innerhalb des deletierten pol-Gens inseriert worden, um drei Stopcodons in drei unterschiedlichen Leserahmen einzubringen, um zu verhindern, dass die restlichen Sequenzen von Integrase translatiert werden. Das gag-Gen von pMTHIVBRU ist ebenfalls modifiziert worden, um die zwei Cysteinreste (Cys392 und Cys395) in der ersten Cys-His-Box durch Serine zu ersetzen.

Somit codiert das Plasmid pMTHIVBRU ein HIV-ähnliches Partikel, welches hinsichtlich einer Vielzahl von Elementen defizient ist, die für das Infektionsvermögen und/oder die Replikation von HIV erforderlich sind, aber für die Herstellung von Virus-ähnlichem Partikel verzichtbar sind.

Das Plasmid pMTHIVBRU codiert ein HIV-ähnliches Partikel mit einem Hüllprotein, welches demjenigen des HIV-1LAI-Isolates entspricht. Unter Bezugnahme auf die 3 wird ein Plasmid p83-19 gezeigt, in welchem die LAI-Hülle von pMTHIVBRU im Wesentlichen durch die MN-Hüll-Sequenz ersetzt worden ist. Daher codiert das Plasmid p83-19 ein HIV-ähnliches Partikel, das hinsichtlich einer Vielzahl von Elementen defizient ist, welche für das Infektionsvermögen und/oder Replikation von HIV erforderlich sind, aber für die Herstellung von Virus-ähnlichem Partikel verzichtbar sind, und enthält als das env-Genprodukt im Wesentlichen die Hülle von HIV-1-Isolat MN. Das HIV-ähnliche Partikel kann andere env-Genprodukte enthalten, insbesondere von klinischen Isolaten aus mit HIV-1 infizierten Patienten, wie ein primäres HIV-1-Isolat aus den Subtypen A, B, C, D, E und O, einschließlich dem spezifischen Isolat bx08. Die env-Genprodukte können auch eine Chimäre von dem gp120-Protein aus einer Quelle und dem Rest aus einer anderen Quelle sein, wie MN/LAI-, bx08/LAI- und Subtypen/LAI-Chimären.

Unter Bezugnahme auf die 4 bis 6 wird die Konstruktion eines Vektors pMTHIV-HA2-701 veranschaulicht, enthaltend ein modifiziertes HIV-Genom, welches hinsichtlich Long-Terminal-Repeats, Primer-Bindungsstelle und einer RNA-Verpackungssequenz defizient ist und gag-, pol- und env-Gene in ihrer natürlichen genomischen Anordnung enthält. Das env-Gen in pMTHIVHA2-701 ist modifiziert worden, um darin ein Gen bereitzustellen, codierend eine unterschiedliche Ankersequenz zum Verankern des env-Genprodukts an dem Retrovirus-ähnlichen Produkt, wodurch das modifizierte env-Gen ein modifiziertes env-Genprodukt codiert, in welchem die endogene Verankerungsfunktion von env durch die unterschiedliche Ankersequenz ersetzt worden ist. In Retrovirus-ähnlichen Partikeln, codiert von pMTHIVHA2-701, wird ein immundominantes Epitop von gp41 (welches die endogene Verankerungsfunktion bereitstellt) nicht länger exprimiert. Daher werden derartige Retrovirusähnliche Partikel in einer negativen Weise durch die Abwesenheit einer Aminosäuresequenz, welche einem Epitop eines retroviralen Proteins entspricht, antigenisch markiert. Die unterschiedliche Ankersequenz kann selbst antigenisch sein, um ferner einen positiven nicht-retroviralen oder nicht-HIV-retroviralen antigenen Marker für die Retrovirus-ähnlichen Partikel vorzusehen.

In dieser besonderen veranschaulichten Ausführungsform der Erfindung wurde eine 135-bp-Sequenz, umfassend ein codierendes DNA-Fragment und ein Stopcodon aus dem humanen Influenzavirus-HA2-Gen, zwischen die Nukleotide 7777 (G) und 7778 (A) des HIV-1-LAI-Hüll-Gens inseriert, um die Synthese des HIV-1-LAI-gp41-Transmembranglykoproteins zu verhindern. Das Plasmid pMTHIVHA2-701 codiert daher ein HIV-ähnliches Partikel, worin die gp41-Transmembranglykoprotein-Verankerungsfunktion durch eine Anker-Sequenz aus dem humanen Influenzavirus-HA2-Protein ersetzt worden ist und das HA2-Protein weiterhin einen antigenen Marker bereitstellt.

Unter Bezugnahme auf die 7 wird das Plasmid pMTHIVmHA2 veranschaulicht, welches ähnlich zu pMTHIVHA2-701 ist, aber als die antigene Markersequenz, welche die endogene Verankerungsfunktion von env ersetzt, eine Aminosäuresequenz ohne Homologie zu bekannten natürlich vorkommenden Proteinen enthält.

Unter Bezugnahme auf 8 wird ein Vektor pMTHIVMNmHA2-5 (ATTC-Bezeichnung 75853) veranschaulicht, welcher ein modifiziertes HIV-Genom enthält, das hinsichtlich Long-Terminal-Repeats, Primer-Bindungsstelle und einer RNA-Verpackungssequenz defizient ist und gag-, pol- und env-Gene in ihrer natürlichen genomischen Anordnung enthält. Das pol-Gen von pMTHIVMNmHA2-5 ist modifiziert worden durch Deletion eines Bereichs davon, um die Reverse-Transkriptase- und Integrase-Aktivitäten davon im Wesentlichen zu entfernen. Weiterhin wurde ein Oligonukleotid innerhalb des deletierten pol-Gens inseriert, um drei Stopcodons in drei verschiedenen Leserahmen einzubringen, um zu verhindern, dass die restlichen Sequenzen von Integrase translatiert werden. Das gag-Gen von pMTHIVMNmHA2-5 ist ebenfalls modifiziert worden, um die zwei Cysteinreste in der ersten Cys-His-Box von gag durch Serine zu ersetzen. In pMTHIVMNmHA2-5 ist die endogene Verankerungsfunktion von env ersetzt worden durch eine Aminosäure-Sequenz ohne bekannte Homologie zu natürlich vorkommenden Proteinen. HIV-ähnliche Partikel, die aus Vero-Zellen hergestellt wurden, welche transfiziert waren mit dem Plasmid pMTHIVMNmHA2-5, wurden gereinigt und verwendet, um Meerschweinchen zu immunisieren. Antiseren wurden aufgefangen und mittels ELISA hinsichtlich Anti-V3- (d. h. Anti-Hüll)-Antikörpern und Anti-mHA2- (d. h. Antiantigener Marker)-Antikörpern geassayt, wie gezeigt in der Tabelle 1. Diese Experimente wurden in anderen Meerschweinchen wiederholt und auf den Assay hinsichtlich Anti-gag-Antikörpern ausgedehnt, und die erhaltenen Ergebnisse werde in der 13 gezeigt. Diese Ergebnisse zeigen, dass die gag- und env-Genprodukte im Wesentlichen in ihrer natürlichen Konformation vorhanden sind, und dass der antigene Marker immunogen ist.

Obwohl besondere Retrovirus-ähnliche Partikel beschrieben worden sind, in welchen die endogene Verankerungsfunktion von env durch die antigene Anker-Sequenz von besonderen natürlichen und unnatürlichen Proteinen ersetzt worden ist, ist davon auszugehen, dass viele Variationen, Anpassungen und Modifikationen an den jeweiligen Methoden vorgenommen werden können, durch welche die endogene Verankerungsfunktion ersetzt werden kann, ohne von dem Kern der Erfindung abzuweichen.

Unter Bezugnahme auf die 9 und 10 werden Plasmide veranschaulicht (pHIV-T1; pHIV-T2 (ATCC-Bezeichnung 75851); pHIV-T3 und pHIV-T4), enthaltend zwischen ein und vier Kopien einer DNA-Sequenz, welche ein antigenes Epitop aus TMV codiert. In den besonderen gezeigten Ausführungsformen wird das TMV-Epitop in das gag-Gen von HIV inseriert, um ein Hybrid-gag-Genprodukt herzustellen, und die Plasmide sind defizient hinsichtlich der Vielzahl von Elementen, welche für Infektionsvermögen und/oder Replikation von HIV erforderlich sind, aber für eine Herstellung Virus-ähnlicher Partikel verzichtbar sind, wie oben beschrieben. Stabile Zelllinien wurden unter Verwendung der Plasmide pHIV-T1, pHIV-T2 (ATCC-Bezeichnung), pHIV-T3 und pHIV-T4 (enthaltend 1, 2, 3 bzw. 4 Kopien des Antigen-Epitops) hergestellt, welche HIV-ähnliche Partikel herstellten, die den antigenen Marker, inseriert in das gag-Protein, enthielten. Diese HIV-ähnlichen Partikel wurden gereinigt, und ihre Reaktivität mit monoklonalen Anti-HIV-Antikörpern (11) und Anti-TMV-Marker-Antiserum (12) wurde bestimmt. Die Ergebnisse sind in den 11 und 12 gezeigt und weisen darauf hin, dass die HIV-ähnlichen Partikel gp120, gp41 und p24 in im Wesentlichen ihren natürlichen Konformationen enthalten, und dass der TMV-Marker in der Lage ist, von Anti-Marker-Antikörpern erkannt zu werden.

Gereinigte HIV-ähnliche Partikel, hergestellt durch das Plasmid pHIV-T2, wurden zum Immunisieren von Meerschweinchen verwendet. Antiseren wurden gesammelt und mittels ELISA hinsichtlich Anti-gag-Antikörpern, Anti-V3- (d.h. Anti-Hülle)-Antikörpern und Anti-TMV- (d. h. Anti-antigener-Marker)-Antikörpern geassayt, wie gezeigt in der 14. Diese Ergebnisse zeigen, dass die gag- und env-Genprodukte in im Wesentlichen ihrer natürlichen Konformation vorhanden sind, und dass der antigene Marker immunogen ist.

Weiterhin wurde ein viraler Infektions-Inhibitions-Assay ausgeführt an den Meerschweinchenseren aus diesen Immunisierungen. Neutralisierende Antikörper wurden gebildet, wie gezeigt in Tabelle 2. Die Erzeugung solcher neutralisierenden Antikörper weist auf die potenzielle Nützlichkeit der Retrovirus-ähnlichen Partikel als Impfstoffkandidaten und bei diagnostischen Anwendungen hin.

Unter Bezugnahme auf die 16 wird eine Immunoblot-Analyse von Retrovirus-ähnlichen Partikeln (Pseudovirion), welche Hüll-Glykoproteine aus dem klinischen (primären) Isolat bx08 exprimieren, gezeigt. HIV-1-bx08 ist ein klinisches Isolat aus dem in Frankreich isolierten Subtyp B. Diese Analyse demonstriert die Expression der Hüll-Glykoproteine aus klinischen Isolaten in einem Molekül, welches gag-Protein eines nicht-klinischen Isolats enthält.

Obgleich spezifische Ausführungsformen der Marker-Sequenzen, welche auch eine Ankersequenz sein können, hierin beschrieben werden, ist es offensichtlich, dass jedwede andere zweckmäßige Aminosäuresequenz, welche Marker- und/oder Verankerungsfunktion bereitstellt, hierin verwendet werden kann, einschließlich der Abwesenheit einer Aminosäuresequenz, welche einem Epitop eines retroviralen Proteins entspricht. Die Abwesenheit einer Aminosäuresequenz, welche einem Epitop von retroviralem Protein entspricht, kann die Mutagenese von einer oder mehreren Aminosäuren aus einer immundominanten Region des env-Genprodukts beinhalten, wie gezeigt in Tabelle 3, um eine Erkennung der immundominanten Region in der resultierenden Mutation durch Seren aus retroviral-infizierten Wirten im Wesentlichen zu verhindern. Die Aminosäuresequenz, welche eine Marker-Funktion bereitstellt, kann eine nicht-natürlich vorkommende antigene Sequenz umfassen, welche keine Homologie zu bekanntem Protein aufweist. Ein Beispiel einer solchen Sequenz ist die oben beschriebene mutante HA2-Sequenz. Andere Beispiele können antigene Regionen von Nicht-Mensch- oder Nicht-Säuger-Protein, wie pathogenen oder kommensalen Nicht-Mensch- oder Nicht-Säuger-Organismen einschließen. Ein Beispiel einer derartigen Sequenz ist das oben beschriebene TMV.

Es ist für den Fachmann auf dem Gebiet deutlich offensichtlich, dass die verschiedenen Ausführungsformen der vorliegenden Erfindung viele Anwendungen auf den Gebieten der Impfung, Diagnose, Behandlung von HIV-Infektionen und der Erzeugung immunologischer Reagenzien besitzen. Eine weitere nicht-einschränkende Diskussion derartiger Anwendungen wird nachstehend ferner präsentiert.

Impfstoffherstellung und -anwendung

Es ist gezeigt worden, dass eine immunogene Präparation gemäß der Erfindung eine Immunantwort hervorrufen kann. Eine mögliche Anwendung der vorliegenden Erfindung besteht deshalb darin, als die Basis eines potenziellen Impfstoffs gegen retrovirale Krankheiten, einschließlich AIDS und AIDS-bedingten bzw. -verwandten Zuständen zu dienen. In einem weiteren Aspekt sieht die Erfindung somit einen Impfstoff gegen AIDS und AIDS-verwandte Zustände vor, welcher eine immunogene Zusammensetzung gemäß der Erfindung umfasst.

Immunogene Zusammensetzungen, welche zum Verwenden als Impfstoffe geeignet sind, können aus den nichtinfektiösen Retrovirus-ähnlichen Partikeln, wie hierin offenbart, hergestellt werden. Die immunogene Zusammensetzung ruft eine Immunantwort hervor, welche Antikörper erzeugt, die antiviral sind. Sollte das geimpfte Subjekt von einem Retrovirus, wie HIV, herausgefordert werden, binden die Antikörper an das Virus und inaktivieren es dadurch.

Impfstoffe können als injizierbare Präparate, als flüssige Lösungen oder Emulsionen hergestellt werden. Die nicht-infektiösen Retrovirus-ähnlichen Partikel können mit pharmazeutisch annehmbaren Exzipienten gemischt werden, welche mit den Retrovirus-ähnlichen Partikeln kompatibel sind. Exzipienten können Wasser, Kochsalzlösung, Dextrose, Glycerol, Ethanol und Kombinationen davon einschließen. Der Impfstoff kann fernerhin Hilfssubstanzen, wie Benetzungs- oder Emulgierungsmittel, pH-Puffermittel oder Adjuvantien zur Steigerung der Effektivität der Impfstoffe enthalten. Verfahren zur Erzielung eines Adjuvans-Effekt für den Impfstoff schließen die Verwendung von Mitteln, wie Aluminiumhydroxid oder -phosphat (Alum), welche üblicherweise als 0,05- bis 0,1-prozentige Lösung in phosphatgepufferter Kochsalzlösung verwendet werden, und anderen Adjuvantien, einschließlich QS21 und unvollständigem Freund'schem Adjuvans, ein. Die Impfstoffe können parenteral, durch Injektion subkutan oder intramuskulär verabreicht werden. Alternativ dazu können die gemäß der vorliegenden Erfindung gebildeten immunogenen Zusammensetzungen in einer Weise formuliert und zugeführt werden, um eine Immunantwort an Schleimhautoberflächen hervorzurufen. Somit kann die immunogene Zusammensetzung an Schleimhautoberflächen beispielsweise auf den nasalen oder oralen (intragastrischen) Wegen verabreicht werden. Alternativ dazu können andere Verabreichungsweisen, einschließlich Suppositorien und oralen Formulierungen, wünschenswert sein. Für Suppositorien können Bindemittel und Träger beispielsweise Polyalkalenglycole oder Triglyceride einschließen. Orale Formulierungen können normalerweise verwendete Träger, wie pharmazeutische Güteklassen von Saccharin, Cellulose und Magnesiumcarbonat, einschließen. Diese Zusammensetzungen nehmen die Form von Lösungen, Suspensionen, Tabletten, Pillen, Kapseln, Formulierungen mit verzögerter Freisetzung oder Pulvern ein, und enthalten 10 bis 95 % an Retrovirus-ähnlichen Partikeln der Erfindung.

Die Impfstoffe werden in einer Weise verabreicht, welche kompatibel mit der Dosierungsformulierung ist und in einer derartigen Menge, wie sie therapeutisch effektiv, schutzgebend und immunogen ist. Die zu verabreichende Quantität hängt von dem zu behandelnden Subjekt ab, einschließlich zum Beispiel dem Vermögen des Immunsystems des Individuums, Antikörper zu synthetisieren und eine zellvermittelte Immunantwort hervorzubringen. Die genauen Mengen an Wirkstoff, welche zur Verabreichung erforderlich sind, hängen von der Beurteilung des behandelnden Arztes ab. Allerdings sind geeignete Dosierungsbereiche vom Fachmann auf dem Gebiet ohne weiteres bestimmbar und können in der Größenordnung von Mikrogramm der Retrovirus-ähnlichen Partikel liegen. Geeignete Schemen zur anfänglichen Verabreichung und Auffrisch- bzw. Booster-Dosierungen sind ebenfalls variabel, können aber eine anfängliche Verabreichung, gefolgt von nachfolgenden Verabreichungen, einschließen. Ein Beispiel eines Immunisierungs-Ablaufschemas besteht in wenigstens einer Prä-Immunisierung mit einem Retrovirus-ähnlichen Partikel, gemäß der vorliegenden Erfindung, gefolgt von wenigstens einer sekundären Immunisierung mit einem synthetischen Peptid, wie beschrieben in der veröffentlichten europäischen Patentveröffentlichung Nr. 0 570 980, zugewiesen an den Patentinhaber hiervon. Die Dosierung des Impfstoffs kann auch von dem Verabreichungsweg abhängen und wird des Weiteren gemäß der Größe des Wirtes variieren.

Nukleinsäuremoleküle, welche die Retrovirus-ähnlichen Partikel der vorliegenden Erfindung codieren, können auch direkt zur Immunisierung durch Verabreichen der Nukleinsäuremoleküle in direkter Weise verwendet werden, zum Beispiel durch Injektion an einen Wirt. Verfahren zur direkten Injektion von DNA in Testsubjekte zur genetischen Immunisierung werden zum Beispiel in Ulmer et al., 1993, beschrieben.

Gemäß der Erfindung hergestellte Moleküle können weiterhin Anwendung in der Behandlung (prophylaktisch oder kurativ) von AIDS und verwandten Zuständen, durch Wirkung entweder zur Verdrängung der Bindung des HIV-Virus an menschliche oder tierische Zellen oder durch Störung der dreidimensionalen Organisation des Virus, finden.

Ein weiterer Aspekt der Erfindung stellt somit ein Verfahren zur Prophylaxe oder Behandlung von AIDS oder damit zusammenhängenden Leiden bereit, umfassend das Verabreichen einer wirksamen Menge einer immnogenen Zusammensetzung gemäß der Erfindung.

Immunoassays

Die Retrovirus-ähnlichen Partikel der vorliegenden Erfindung sind nützlich als Immunogene, als Antigene in Immunoassays, einschließlich 'Enzyme-Linked-Immunosorbent'-Assays (ELISA), RIAs und anderen nicht-enzymverknüpften Antikörper-Bindungsassays, oder Vorgehensweisen, welche im Fachgebiet bekannt sind für die Detektion von anti-retroviralen (zum Beispiel HIV) HIV-Antikörpern und retroviralem Antigen (zum Beispiel HIV). In ELISA-Assays werden die Retrovirus-ähnlichen Partikel auf einer gewählten Oberfläche, zum Beispiel einer Oberfläche, die zum Binden von Proteinen in der Lage ist, wie den Vertiefungen einer Polystyrol-Mikrotiterplatte, immobilisiert. Nach Waschen zum Entfernen von unvollständig adsorbierten Retrovirus-ähnlichen Partikeln, kann ein nicht-spezifisches Protein, wie eine Lösung von Rinderserumalbumin (BSA) oder Casein, welches bekanntermaßen antigenisch neutral in Bezug auf die Testprobe ist, an die gewählte Oberfläche gebunden werden. Dies gestattet die Blockierung von nicht-spezifischen Adsorptionsstellen auf der immobilisierenden Oberfläche und verringert somit den Hintergrund, der durch nicht-spezifische Bindungen von Antiseren auf die Oberfläche verursacht wird.

Die immobilisierende Oberfläche wird dann mit einer Probe, wie zu testenden klinischen oder biologischen Materialien, in einer Weise kontaktiert, welche für eine Immunkomplex(Antigen/Antikörper)-Bildung förderlich ist. Dies kann das Verdünnen der Probe mit Verdünnungsmitteln, wie Lösungen von BSA, Rindergammaglobulin (BGG) und/oder phosphatgepufferter Kochsalzlösung (PBS)/Tween, einschließen. Die Probe wird dann etwa 2 bis 4 Stunden lang bei Temperaturen wie von der Größenordnung von etwa 25° bis etwa 37°C inkubieren gelassen. Im Anschluss an die Inkubation wird die mit den Proben kontaktierte Oberfläche gewaschen, um nicht-immunkomplexiertes Material zu entfernen. Das Waschvorgehen kann das Waschen mit einer Lösung, wie PBS/Tween oder einem Boratpuffer, einschließen.

Im Anschluss an die Bildung von spezifischen Immunkomplexen zwischen der Testprobe und den gebundenen Retrovirus-ähnlichen Partikeln und anschließendem Waschen können das Auftreten und sogar die Menge der Immunkomplex-Bildung bestimmt werden durch Unterziehen des Immunkomplexes an einen zweiten Antikörper mit Spezifität für den ersten Antikörper. Wenn die Testprobe von menschlichem Ursprung ist, ist der zweite Antikörper ein Antikörper mit Spezifität für menschliche Immunglobuline und im Allgemeinen IgG. Um Nachweismittel vorzusehen, kann der zweite Antikörper eine assoziiierte Aktivität aufweisen, wie eine enzymatische Aktivität, welche beispielsweise eine Farbentwicklung nach Inkubieren mit einem geeigneten chromogenen Substrat hervorbringen wird. Eine Quantifizierung kann dann durch Messen des Ausmaßes der Farberzeugung zum Beispiel unter Anwendung eines Spektrophotometers für sichtbare Spektren erreicht werden.

In einer diagnostischen Ausführungsform, in der es wünschenswert ist, Antikörper zu identifizieren, welche eine Vielzahl von HIV-Isolaten erkennen, wird eine Vielzahl von immunologisch verschiedenen Retrovirus-ähnlichen Partikeln der vorliegenden Erfindung auf die gewählte Oberfläche immobilisiert. Wenn die Anti-HIV-Antikörper Epitope erkennen, welche unter verschiedenen HIV-Isolaten hochkonserviert sind (zum Beispiel ein B-Zell-Epitop aus gag oder gp41), kann alternativ dazu ein einzelnes oder eine begrenzte Anzahl an Retrovirusähnlichen Partikeln immobilisiert werden. In einer weiteren diagnostischen Ausführungsform, worin es wünschenswert ist, Antikörper spezifisch zu identifizieren, welche ein einzelnes HIV-Isolat (zum Beispiel LAI, MN, SF2 oder HXB2) erkennen, kann ein einzelnes besonderes Retrovirus-ähnliches Partikel der vorliegenden Erfindung immobilisiert werden. Diese weitere diagnostische Ausführungsform besitzt besondere Nützlichkeit auf den Gebieten der Medizin, klinischen Studien, Gerichts- und Forensik-Wissenschaft, wo es ausschlaggebend sein kann, das besondere HIV-Isolat zu bestimmen, welches für die Erzeugung einer Immunantwort, einschließlich einer Antikörperantwort, verantwortlich war.

In einer weiteren diagnostischen Ausführungsform kann es wünschenswert sein, immunologisch distinkte Retroviren spezifisch zu identifizieren, beispielsweise HIV-Isolate, welche unterschiedlichen Subtypen angehören. Immunologisch distinkte HIV-Isolate können zum Beispiel LAI, MN, SF2, HXB2 oder ein primäres HIV-1-Isolat einschließen. In dieser diagnostischen Ausführungsform ist ein jeweiliges Retrovirus-ähnliches Partikel der vorliegenden Erfindung nützlich zum Erzeugen von Antikörpern, einschließlich monoklonalen Antikörpern, welche ein solches immunologisch distinktes HIV-Isolat spezifisch erkennen.

Es versteht sich, dass eine Mischung von immunologisch distinkten Retrovirus-ähnlichen Partikeln entweder als ein Immunogen zum Beispiel in einem Impfstoff oder als ein diagnostisches Agens verwendet werden kann. Es kann Umstände geben, bei welchen eine Mischung von Retrovirus-ähnlichen Partikeln verwendet wird, um Kreuz-Isolat-Schutz und/oder -Diagnose vorzusehen. In diesem Fall wird die Mischung von Immunogenen üblicherweise als ein "Cocktail"-Präparat bezeichnet.

Die vorliegende Erfindung sieht in vorteilhafterweise Retrovirus-ähnliche Partikel vor, welche gag-, pol- und env-Genprodukte im Wesentlichen in ihren natürlichen Konformationen umfassen. Solche Retrovirus-Partikel werden somit von konformationalen Anti-HIV-Antikörpern (wie Anti-env-Antikörpern) erkannt, welche das HIV-Antigen in einer denaturierten Form oder ein synthetisches Peptid, welches einem solchen HIV-Antigen entspricht, nicht erkennen können. Die Retrovirus-ähnlichen Partikel der Erfindung sind deshalb besonders nützlich als Antigene und als Immunogene in der Erzeugung von anti-retroviralen Antikörpern (einschließlich monoklonalen Antikörpern) in diagnostischen Ausführungsformen.

Darüber hinaus erzeugt die Gegenwart des Markers eine spezifische Immunantwort gegen selbigen, deren Detektion durch die oben beschriebenen Verfahren die einfache Unterscheidung zwischen einer Immunisierung eines Wirtes mit den hierin bereitgestellten immunogenen Zusammensetzungen verglichen zu Material-Infektion durch ein virulentes Retrovirus ermöglicht. Die Fähigkeit, eine derartige Diagnose und Unterscheidung zu bewirken, besitzt vorteilhafte Anwendbarkeit auf den Gebieten der Epidemiologie, klinischen Studien, forensischen Wissenschaft und Immunologie.

Andere Verwendungen

Moleküle, welche an die Retrovirus-ähnlichen Partikel, auf denen die Erfindung basiert, binden, insbesondere Antikörper, Antikörper-verwandte Moleküle und Strukturanaloga davon, sind ebenfalls von möglichen Nutzen als Mittel in der Behandlung und Diagnose von AIDS und verwandten Zuständen.

Varianten von Antikörpern (einschließlich Varianten der Antigen-Bindungsstelle), wie chimäre Antikörper, humanisierte Antikörper, furnierte Antikörper und technisch konstruierte Antikörper, welche für die Retrovirus-ähnlichen Partikel spezifisch sind, sind innerhalb des Umfangs der Erfindung eingeschlossen.

Antikörper und andere Moleküle, welche an die Retrovirus-ähnlichen Partikel der vorliegenden Erfindung binden, können für therapeutische (prophylaktische und kurative) und diagnostische Zwecke in einer Anzahl von verschiedenen Weisen verwendet werden, einschließlich den Folgenden:

zur passiven Immunisierung durch geeignete Verabreichung von Antikörpern, möglicherweise humanisierten Antikörpern, an HIV-infizierte Patienten,

zum Aktivieren des Komplements oder zum Vermitteln von Antikörper-abhängiger zellulärer Cytotoxizität (ADCC) durch Verwendung von Antikörpern einer geeigneten Unterklasse oder eines geeigneten Isotyps (möglicherweise erhalten durch passendes Antikörper-Konstruieren), um in der Lage zu sein, die gewünschte Funktion auszuführen,

für die zielgerichtete Zuführung von Toxinen oder anderen Mitteln, zum Beispiel durch Verwendung von Immuntoxinen, welche Konjugate von Antikörper und einem cytotoxischen Rest umfassen, für eine direkte oder indirekte Bindung an Zelloberflächen-exponierte HIV-Proteine von HIV-infizierten Zellen (zum Beispiel gp120),

für die zielgerichtete Zuführung von hochimmunogenen Materialien an die Oberfläche von HIV-infizierten Zellen, was zu einer möglichen Beseitigung solcher Zellen entweder durch das humorale oder zelluläre Immunsystem des Wirtes führt,

für eine Detektion von HIV unter Anwendung einer Vielzahl von Immunoassay-Techniken.

Somit sind in noch einer weiteren diagnostischen Ausführungsform, die immunogenen Zusammensetzungen der vorliegenden Erfindung (einzeln oder als Mischungen, einschließlich Cocktail-Präparationen) brauchbar für die Erzeugung von HIV-Antigen-spezifischen Antikörpern (einschließlich monoklonalen Antikörpern), welche verwendet werden können, um HIV oder Antigene zu detektieren oder HIV in Proben, einschließlich biologischen Proben, zu neutralisieren.

In einer alternativen diagnostischen Ausführungsform können die Retrovirus-ähnlichen Partikel der vorliegenden Erfindung verwendet werden, um HIV-spezifische T-Zellen in biologischen Proben, zum Beispiel aus HIV-infizierten Individuen, für die Diagnose oder Therapie spezifisch zu stimulieren.

Biologische Hinterlegungen

Bestimmte Plasmide, welche Retrovirus-ähnliche Partikel gemäß Aspekten der vorliegenden Erfindung codieren, welche hierin beschrieben sind und auf welche hierin Bezug genommen wird, sind bei der American Type Culture Collection (ATCC), welche sich in 12301 Parklawn Drive, Rockville, Maryland, USA, 20852, befindet, unter Befolgung des Budapester Vertrages und vor der Einreichung dieser Patentanmeldung hinterlegt worden. Proben der hinterlegten Plasmide werden der Öffentlichkeit nach Erteilung eines Patentes, basierend auf dieser US-Patentanmeldung zugänglich gemacht werden. Die hierin beschriebene und beanspruchte Erfindung ist hinsichtlich des Umfangs nicht durch hinterlegte Plasmide beschränkt, da die hinterlegte Ausführungsform lediglich als eine Veranschaulichung der Erfindung beabsichtigt ist. Jedwede äquivalenten oder ähnlichen Plasmide, welche ähnliche oder äquivalente Retrovirusähnliche Partikel, wie beschrieben in dieser Patentanmeldung, codieren, liegen innerhalb des Umfangs der Erfindung.

Hinterlegungszusammenfassung

Die obenstehende Offenbarung beschreibt die vorliegende Erfindung im Allgemeinen. Ein vollständigeres Verständnis kann durch Bezugnahme auf die folgenden spezifischen Beispiele erhalten werden. Diese Beispiele sind lediglich zu Zwecken der Veranschaulichung beschrieben und mit ihnen wird nicht beabsichtigt, den Umfang der Erfindung zu beschränken. Obwohl spezifische Begriffe hierin verwendet worden sind, sind derartige Begriffe in einem beschreibenden Sinn und nicht zu Zwecken von Einschränkungen beabsichtigt. Immunologische und rekombinante DNA-Verfahren können in dieser Offenbarung nicht explizit beschrieben werden, liegen aber allgemein innerhalb des Kenntnisstandes des Fachmanns auf dem Gebiet.

BEISPIELE

Verfahren der Molekulargenetik, Proteinbiochemie und Immunologie, welche in dieser Offenbarung und diesen BEISPIELEN angewandt aber nicht explizit beschrieben werden, sind umfassend in der wissenschaftlichen Literatur berichtet und liegen allgemein innerhalb des Kenntnisstandes des Fachmanns auf dem Gebiet.

Beispiel 1:

Dieses Beispiel beschreibt die Konstruktion des Plasmids pMTHIVBRU.

Das Plasmid pMTHIVBRU wurde konstruiert, wie gezeigt in den 1 und 2. Dieses Plasmid ist eine Modifikation des Expressionsvektors pMTHIVd25, beschrieben in Rovinski et al., 1992 (die Literaturbezugsstellen sind am Ende der Beschreibung angegeben), und welches eine RNA-Verpackungs-Deletion enthält, und wurde konstruiert, um eine Reihe von Mutationen/Deletionen zu enthalten. So schloss eine Cys-His-Box-Mutation Ersetzungen von zwei Cystein-Codons (in SEQ. ID. Nr.: 13) mit zwei Serinen-Codons in der ersten Cys-His-Box (SEQ. ID. Nr.: 14) des gag-Proteins ein, wie gezeigt in der 1. Dies wurde bewerkstelligt durch ein PCR-basierendes Mutagenese-Verfahren. Es wurden zwei Primer synthetisiert: der Stromaufwärts-Primer mit der Sequenz 5'-GGACTAGTACCCTTCAGGAACAAATAGGATGGATGACAAATAATCCACCTATCCCAGTAGGAG-3' (SEQ. ID. Nr.: 15), umfassend die Nukleotide 1507 bis 1567 von HIV-1LAI (sämtliche Nukleotid-Nummerierung erfolgt gemäß Wain-Hobson et al., 1985) mit einer SpeI-Stelle am 5'-Ende; und der Stromabwärts-Primer mit der Sequenz 5'-CTCGGGCCCTGCAATTTCTGGCTATGTGCCCTTCTTTGCCACTATTGAAACTCTTAACAATC-3' (SEQ. ID. Nr.: 16), welcher das reverse Komplement der Nukleotide 2011 bis 1953 mit einer ApaI-Ste11e am 5'-Ende ist. Im Stromabwärts-Primer wurden die zwei Adenosinreste, welche das reverse Komplement der Nukleotide 1963 und 1972 (Wain-Hobson et al., 1985; Myers et al., 1990) repräsentieren, zu Thymidin verändert, was zur Ersetzung der zwei Cysteine an den Aminosäurepositionen 392 und 395 des gag-Genprodukts durch zwei Serine führt (1). Diese zwei Primer wurden verwendet, um das SpeI-ApaI-DNA-Fragment (Nukleotide 1507 bis 2006) von pMTHIV (Rovinski et al., 1992), welches als eine Matrize verwendet wurde, zu amplifizieren. Das PCR-amplifizierte SpeI-ApaI-Fragment wurde durch Agarosegelelektrophorese gereinigt und mit den Restriktionsenzymen SpeI und ApaI verdaut. Dieses Fragment wurde verwendet, um das entsprechende Fragment in pMTHIVd25 (Rovinski et al., 1992) zu ersetzen. Das resultierende Plasmid wurde pMTHIV-A genannt, welches sowohl die RNA-Verpackungssequenz-Deletion als auch die Cys-His-Box-Mutation enthält.

Um die reverse Transkriptase und Integrase zu deletieren, wurden zwei BalI-Erkennungsstellen an den Nukleotiden 2655 und 4587 von HIV-1LAI verwendet (2). Das 1,9-kbp-Fragment zwischen den zwei BalI-Stellen enthält DNA-Sequenzen, welche mehr als 95% der reversen Transkriptase und die ersten 108 Aminosäuren der Integrase codieren. Das Plasmid pMTHIV-A wurde mit BalI verdaut. Nach Entfernen des 1,9 kbp großen BalI-Fragments durch Gelelektrophorese wurde der verbleibende Teil des Plasmids mit einem doppelsträngigen Oligonukleotid ligiert: 5'-GTATAAGTGAGTAGCGGCCGCAC-3' (es wird nur ein Strang gezeigt – SEQ. ID. Nr.: 17), welches drei Stopcodons in drei unterschiedlichen Leserastern enthält, um zu verhindern, dass die restlichen Sequenzen von Integrase translatiert werden. Das resultierende Plasmid wurde pMTHIVBRU genannt.

Beispiel 2:

Dieses Beispiel beschreibt die Konstruktion von Plasmiden, welche HIV-ähnliche Partikel codieren, die antigenisch markierte Hüll-Anker enthalten.

Das Plasmid p83-19 wurde aus dem Expressionsvektor pMTHIVBRU, wie gezeigt in 3, konstruiert. Dieses Plasmid enthält ein Hybrid-Hüll-Gen, welches durch Ersetzen von DNA, codierend den Großteil von gp120LAI, mit der entsprechenden bzw. kognaten DNA, codierend gp120MN, technisch hergestellt wurde. Dies erfolgte durch Ersetzen eines KpnI/BglII-DNA-Fragments (Nukleotide 6379 bis 7668) aus HIV-1LAI, mit einem KpnI/BglII-DNA-Fragment (Nukleotide 6358 bis 7641) aus HIV-1MN.

Das Plasmid pMTHIVHA2-701 wurde aus den Expressionsvektoren pBT1 (Alizon et al., 1984) und pMTHIVd25 (Rovinski et al., 1992), konstruiert, wie gezeigt in den 4 bis 6. Der pMTHIVHA2-701-Vektor enthält eine 135-bp-Sequenz, umfassend ein codierendes DNA-Fragment und ein Stopcodon aus dem humanen Influenzavirus-HA2-Gen (Min Jou et al., 1980), inseriert zwischen den Nukleotiden 7777 (G) und 7778 (A) des HIV-1LAI-Hüll-Gens (Wain-Hobson et al., 1985; Myers et al., 1990). Das Stopcodon wurde inseriert, um die Synthese des HIV-1LAI-gp41-Transmembranglykoproteins zu verhindern. Ein SalI(Nukleotid 5821)BamHI(Nukleotid 8522)-DNA-Fragment aus pBT1 wurde in pSelect (Promega) subkloniert, um pSeBS herzustellen (4). Das letztere Plasmid wurde zur Insertion der 135-bp mittels einer Vorgehensweise verwendet, welche hierin als "Gen-Assemblierungsunterstützte Mutagenese (GAAM)" bezeichnet wird. Ein mutagener Primer, welcher entworfen wurde, um die 135-bp-Sequenz zu enthalten, umfassend ein codierendes DNA-Fragment aus dem humanen Influenazvirus-HA2-Gen (Min Jou et al., 1980), wurde assembliert, wie gezeigt in der 5. Das Oligonukleotid I ist ein 99mer, enthaltend (von 3' nach 5') 30 Basen, komplementär zu den Nukleotiden 7748 bis 7777 von HIV-1LAI (Wain-Hobson et al., 1985; Myers et al., 1990) und 69 Basen, welche komplementär zu HA2-Gensequenzen (Min Jou et al., 1980) sind, codierend die Aminosäuren 180 bis 202 des HA2-Proteins. Das Oligonukleotid II ist ein 96mer, das (von 3' nach 5') i) 60 Basen, komplementär zu HA2-Gensequenzen, welche die Aminosäuren 203 bis 221 des HA2-Proteins codieren und das HA2-Stopcodon enthalten (Min Jou et al., 1980), ii) 6 Basen (ATCATT – SEQ. ID. Nr.: 18), welche zwei weitere Stopcodons definieren, und iii) 30 Basen, komplementär zu den Nukleotiden 7778 bis 7807 von HIV-1LAI (Wain-Hobson et al., 1985; Myers et al., 1990), umfasst. Das Oligonukleotid III ist ein Verbrückungs-30mer, aufweisend 15 Nukleotide, komplementär zum 5'-Ende von Oligonukleotid I, und 15 Nukleotide, komplementär zum 3'-Ende von Oligonukleotid II. Zehn Picomol der Oligonukleotide I und II wurden mit 20 Picomol Oligonukleotid III gemischt und bei 37°C während 1,5 Stunden in 20 &mgr;l Kinase-Puffer (50 mM Tris-HCl, pH 7,5, 10 MM MgCl2, 10 mm KCl, 5 MM DTT und 0,5 MM ATP), enthaltend 2 Units T4-Polynukleotidkinase, phosphoryliert. Die Oligonukleotide wurden durch Erwärmen der Mischung auf 95°C während 5 Minuten und anschließendes Abkühlen derselben in langsamer Weise bis Raumtemperatur aneinandergelagert. Zu dieser Mischung wurden 3 &mgr;l 10x-Ligasepuffer (0,5 M Tris-HCl, pH 7,4, 0-1 M MgCl2, 0,1 M DTT, 10 mM Spermidin und 1 mg/ml BSA), 3 &mgr;l 10 mM ATP und 5 Units T4-DNA-Ligase zugesetzt, und die Ligationsmischung wurde über Nacht bei 16°C inkubiert, um den Zusammenbau des mutagenen Primers zu vervollständigen (5). Dieser Primer wurde in der Mutagenese-Vorgehensweise ohne weitere Reinigung verwendet.

Eine Mutagenese wurde unter Verwendung des "Abgeänderte-Stellen"-in-vitro-Mutagenese-Systems von Promega (Madison, WI) durchgeführt. Die Matrize für die Mutagenese bestand aus dem Plasmid pSeBS (4), welche das 2,7 kbp große SalI/BamHI-DNA-Fragment des HIV-1LAI-Hüllen-Gens (Nukleotide 5821 bis 8522) enthielt, das in den pSelect-Phagemid-Vektor kloniert war, der im Mutagenese-Kit bereitgestellt wurde. Im Anschluss an das Mutagenese-Vorgehen wurden vermeintliche Klone durch Koloniehybridisierung mit einer 32P-markierten Oligonukleotid III-Sonde identifiziert. Positive Klone wurden durch DNA-Sequenzierung bestätigt. Einer dieser Klone, bezeichnet als pSeBS-HA2, wurde für die Konstruktion des letztendlichen Vektors verwendet. Zu diesem Zweck wurde das modifizierte SalI/BamHI-Insert aus pSeBS-HA2 in pMTHIVd25-dSalI subkloniert; das letztere ist ein Plasmid, abgeleitet aus pMTHIVd25 (Rovinski et al., 1992) durch partiellen Verdau mit SalI, gefolgt von Klenow-Behandlung, um die SalI-Stelle innerhalb des Plasmid-Grundgerüsts zu eliminieren. Das letztendliche Expressionskonstrukt wurde pMTHIVHA2-701 genannt.

Ein Expressionsvektor, pMTHIVmHA2 (gezeigt in 7), der eine heterologe DNA-Sequenz, inseriert zwischen den Nukleotiden 7777 (G) und 7778 (A) des HIV-1LAI-Hüll-Gens (Rovinski et al., 1992; Wain-Hobson et al., 1985), enthielt, wurde konstruiert, wie obenstehend beschrieben. In diesem Fall wurde eine 134-bp-Sequenz, umfassend ein codierendes DNA-Fragment aus dem humanen Influenzavirus-HA2-Gen (Min Jou et al., 1990) und 68 Nukleotide, welche, wenn sie an die HA2-Sequenzen fusioniert sind, eine Aminosäuresequenz mit keiner Homologie zu bekannten natürlich vorkommenden Proteinen codieren, stromabwärts von Nukleotid 7777 von HIV-1LAI inseriert (7). Die Insertion führte zu einem Rasterschub in der Translation von HIV-1LAI-codierenden Sequenzen und zur Erzeugung eines Stopcodons (TAG), um die Synthese des gp41-Transmembranglykoproteins von HIV-1LAI zu verhindern. Das letztendliche Expressionskonstrukt wurde pMTHIVmHA2 genannt (7).

Das Plasmid pMTHIVMNmHA2-5 wurde aus den Expressionsvektoren p83-19 und pMTHIVmHA2 konstruiert, wie gezeigt in der 8. Dieses Plasmid wurde entworfen, um alle der Mutationen von Elementen, erforderlich für das Infektionsvermögen und/oder die Replikation von p83-19, aufzuweisen und die 134 bp große Insert-Sequenz von pMTHIVmHA2 zu enthalten (7). Zu diesem Zweck wurde p83-19 mit BglII (Nukleotid 7641) und XhoI (Nukleotid 8944) verdaut, um ein 1276 bp großes DNA-Fragment zu entfernen, welches durch das entsprechende BglII/XhoI-Fragment von pMTHIVmHA2 ersetzt wurde.

Beispiel 3

Dieses Beispiel beschreibt die Konstruktion von Plasmiden, welche HIV-ähnliche Partikel codieren, die antigene Epitope aus TMV enthalten.

Die Plasmide pHIV-T1, pHIV-T2, pHIV-T3 und pHIV-T4 repräsentieren modifizierte Versionen des p83-19-Konstrukts dahingehend, dass sie jeweilig entweder eine, zwei, drei oder vier Kopien eines doppelsträngigen Oligonukleotids (9, 10 und 11) enthalten, umfassend mindestens ein antigenes Epitop (Westhof et al., 1984; Trifilleff et al., 1991) aus TMV-Hüllprotein. Die Konstruktion dieser vier Vektoren ist in den 9 und 10 veranschaulicht. Um alle Konstrukte technisch zu erzeugen, wurde das Plasmid pMTHIV-A (1) zuerst mit SacII und ApaI verdaut, um ein 1328 bp großes DNA-Fragment zu isolieren, welches dann in pBluescript (Stratagene) subkloniert wurde. Das rekombinante Plasmid wurde dann mit PstI verdaut, welches HIV-1LAI-DNA am Nukleotid 1415 innerhalb des gag-Gens spaltet. Anschließend wurden entweder eine, zwei, drei oder vier Kopien des in 9 gezeigten doppelsträngigen Oligonukleotids (codierender Strang: SEQ. ID. Nr.: 19, komplementärer Strang: SEQ. ID. Nr.: 20, codierte Aminosäuren: SEQ. ID. Nr.: 21) in diese Restriktionsstelle inseriert. Schließlich wurden die resultierenden rekombinanten Plasmide mit SacII und ApaI verdaut, um das modifizierte Insert freizusetzen, welches dann in die entsprechende Region von Plasmid p83-19 kloniert wurde (10).

Die Expression von Retrovirus-ähnlichen Partikeln, enthaltend entweder das mHA2-Epitop oder verschiedene Kopien des TMV-Epitops, ist in der 11 abgebildet. Vero-Zellen wurden bis zu 80% Konfluenz wachsen gelassen und mit 20 &mgr;g Plasmid-DNA mittels der Transfinity (BRL)-Calciumphosphat-Vorgehensweise transfiziert. Kulturüberstande wurden hinsichtlich Proteinexpression 48 Stunden nach der Transfektion analysiert. Kulturmedien (10 ml) aus Zellen, welche mit individuellen Expressionskonstrukten transfiziert worden waren, wurden abgesammelt und durch Zentrifugation bei 2000 × g (Sorvall RT 6000B; Dupont Company, Wilmington, Del.) während 15 Minuten bei 4°C geklärt. Retrovirus-ähnliche Partikel wurden durch Ultrazentrifugation isoliert. Pelletierte Partikel wurden zu 40 &mgr;l TNE suspendiert, mit 10 &mgr;l 5 × Laemmli-Probenpuffer gemischt und 3 Minuten lang gekocht. Virale Proteine wurden dann mittels SDS-PAGE aufgetrennt und auf Immobilon-Membranen (Millipore, Bedford, Mass.) transferiert. Die Membranen wurden mit BLOTTO-Puffer (PBS, enthaltend 5% fettfreie "Carnation"-Instant-Trockenmilch, 0,0001 % w/v Thimerosal und 0,01 % v/v "Antifoam-A"-Emulsion) während 2 Stunden bei 25°C blockiert und dann mit geeigneten Verdünnungen von Antikörpern über Nacht bei 4°C inkubiert. Die Filter wurden dann inkubiert mit einem Ziege-Anti-Maus-Immunglobulin-G-Antikörper, welcher an Alkalische Phosphatase konjugiert war (Promega, Madison, Wis.), und mit den chromogenen Substraten Nitroblau-Tetrazoliumchlorid und 5-Brom-4-chlor-3-indolylphosphat-p-toluidin-Salz (BRL) für Alkalische Phosphatase umgesetzt. Ein Cocktail von Anti-gp120-, Anti-gp41- und Anti-p24-Antikörpern wurde in Tafel A verwendet. Eine Mischung von Anti-gp120- und Anti-p24-Antikörpern wurde in Tafel B verwendet.

Die in 11 gezeigten Ergebnisse verdeutlichen, dass die antigenisch markierten HIV-ähnlichen Partikel gp120, gp41 und p24 im Wesentlichen in ihren natürlichen Konformationen herstellen.

Beispiel 4:

Dieses Beispiel beschreibt die Immunogenizität und Immunreaktivität von antigenisch markierten HIV-ähnlichen Partikeln.

Eines der Plasmide pHIV-T1, pHIV-T2, pHIV-T3 oder pHIV-T4 (10) wurde mit dem Plasmid pSV2neo in Vero-Zellen cotransfiziert, und stabile Zelllinien wurden etabliert, welche HIV-ähnliche Partikel produzieren. HIV-ähnliche Partikel wurden gereinigt, und ihre Reaktivität gegenüber Immunseren aus Meerschweinchen, welche immunisiert worden waren mit einem Peptid, entsprechend dem TMV-Marker, inseriert in das gag-Genprodukt, wurde mittels Immunoblot-Analyse bestimmt. Um die Immunseren zu erhalten, wurden Meerschweinchen mit 100 &mgr;g eines Peptids immunisiert, bestehend aus dem TMV-Marker, welcher an KLH konjugiert war, und adjuvantiert in Freund'schem vollständigen Adjuvans. Alle Tiere erhielten dreimalig eine Auffrischungsdosis in 3-Wochen-Intervallen mit dem gleichen Peptid, adjuvantiert in Freund'schem unvollständigen Adjuvans. Immunseren wurden zwei Wochen nach den letzten Auffrisch-Verabreichungen abgesammelt. Die Ergebnisse, präsentiert in der 12, veranschaulichen die Reaktivität der Immunseren gegenüber verschiedenen Formen des gag-Genprodukts, vorhanden in den verschiedenen HIV-ähnlichen Partikeln, und zeigen die Antigenizität des TMV-Markers im Kontext eines modifizierten HIV-1-ähnlichen Partikels.

In einer weiteren Untersuchung wurden Meerschweinchen mit 10 &mgr;g gag-p24-Äquivalent-Mengen von HIV-ähnlichen Partikeln, enthaltend zwei Kopien der TMV-Markersequenz (GAFDTRNRIIEVENGA, SEQ. ID. Nr.: 21), immunisiert und erhielten eine Auffrischimpfung mit 5 &mgr;g der gleichen HIV-ähnlichen Partikel bei Drei-Wochen-Intervallen. Die HIV-ähnlichen Partikel waren adjuvantiert mit Freund'schem vollständigem Adjuvans (und Auffrischungsdosen waren mit unvollständigem Freund'schem Adjuvans adjuvantiert) oder QS21. Seren-Proben wurden nach elf Wochen nach der ersten Immunisierung entnommen und hinsichtlich Reaktivität mittels ELISA mit Peptiden getestet, welche der Aminosäuresequenz entsprechen, enthaltend das V3-neutralisierende-Epitop von HIV-1 MN (TRPNYNKRKRIHIGPGRAFYTTKNIIGTIRQAHC, SEQ. ID. Nr.: 31), die TMV-Marker-Sequenz (AFDTRNRIIEVEN, SEQ. ID. Nr.: 1) und das p24(gag)-Protein, hergestellt aus einer rekombinanten Quelle. Die Ergebnisse sind in der 14 gezeigt und weisen darauf hin, dass die HIV-ähnlichen Partikel, enthaltend die TMV-Marker-Sequenz, eine Immunantwort erzeugen können, um Antikörper herzustellen, welche p24 (gag), gp120 (und spezifisch das V3-neutralisierende-Epitop) und die TMV-Marker-Sequenz spezifisch erkennen. Die Meerschweinchen-Antiseren wurden ebenfalls hinsichtlich Virus-Neutralisation unter Verwendung eines Virusinfektions-Inhibitionsassays getestet, wie beschrieben von Skinner et al., 1988. Die Endpunkt-Titer sind in der Tabelle 2 gezeigt und weisen darauf hin, dass Antikörper, hergestellt durch Immunisierung mit den Retrovirus-ähnlichen Partikeln, welche die TMV-Marker-Sequenz exprimieren, in der Lage sind, eine Zellinfektion durch HIV zu inhibieren.

Das Plasmid pMTHIVMNmHA2-5 wurde mit dem Plasmid pSV2neo in Vero-Zellen cotransfiziert, und eine stabile Zelllinie wurde etabliert, welche HIV-ähnliche Partikel produziert. HIV-ähnliche Partikel wurden dann gereinigt, und Meerschweinchen wurden mit 10 &mgr;g gag-p24-Äquivalent-Mengen von HIV-ähnlichen Partikeln immunisiert, welche in Freund'schem vollständigen Adjuvans adjuvantiert waren. Alle Tiere erhielten dreimal eine Auffrischungsdosis bei 3-Wochen-Intervallen mit HIV-ähnlichen Partikeln, welche in Freund'schem unvollständigen Adjuvans adjuvantiert waren. Zwei Wochen nach den letzten Auffrischungs-Verabreichungen wurden Immunseren abgenommen und mittels ELISA hinsichtlich Anti-V3- und Anti-mHA2-Marker-Reaktivitäten geassayt. Die Ergebnisse, welche in der nachstehenden Tabelle 1 präsentiert werden, weisen darauf hin, dass Meerschweinchen, welche mit HIV-ähnlichen Partikeln, die den mHA2-Marker enthalten, immunisiert wurden, Antikörper herstellten, die in der Lage waren, Peptide zu erkennen, welche den mHA2-Marker (MHA-1) und V3-Schleifen-Neutralisations-Domänen (CLTB56, CLTB71 und CLTB73) repräsentierten.

In einer weiteren Untersuchung wurden Meerschweinchen mit 10 &mgr;g gag-p24-Äquivalent-Mengen von HIV-ähnlichen Partikeln immunisiert, welche die Sequenz des antigenen Markers mHA2 enthielten, und erhielten dreimalig eine Auffrischimpfung bei Drei-Wochen-Intervallen mit 5 &mgr;g der gleichen HIV-ähnlichen Partikel. Die HIV-ähnlichen Partikel waren adjuvantiert mit Freund'schem vollständigem Adjuvans (und Auffrischdosen waren mit unvollständigem Freund'schem Adjuvans adjuvantiert), QS21 oder Aluminiumphosphat (ALUM). Seren-Proben wurden aus den Tieren elf Wochen nach der ersten Immunisierung entnommen und hinsichtlich der Reaktivität mit Peptiden getestet, entsprechend der Aminosäuresequenz, enthaltend das V3-Neutralisierungs-Epitop von HIV-1MN (TRPNYNKRKRIHIGPGRAFYTTKNIIGTIRQAHC, SEQ. ID. Nr.: 31), die mHA2-Sequenz (GPAKKATLGATFAFDSKEEWCREKKEQWE, SEQ. ID. Nr.: 22) und das p24(gag)-Protein, welches aus einer rekombinanten Quelle hergestellt wurde. Die Ergebnisse sind in der 13 gezeigt und weisen darauf hin, dass die HIV-ähnlichen Partikel, welche die mHA2-Marker-Sequenz enthalten, Antikörper erzeugen können, welche p24(gag), gp 120 (und spezifisch das V3-neutralisierende Epitop) und die mHA2-Markersequenz spezifisch erkennen können. Die Meerschweinchen-Antiseren wurden ebenfalls hinsichtlich ihrer Fähigkeit getestet, Infektion durch HIVMN zu verhindern, wie beschrieben von Skinner et al., 1988. Die Endpunkt-Titer sind in der Tabelle 2 gezeigt und weisen darauf hin, dass Antikörper, hergestellt durch Immunisierung mit den Retrovirus-ähnlichen Partikeln, welche die mHA2-Marker-Sequenz exprimieren, in der Lage sind, Zellinfektion durch HIV zu inhibieren. Diese Daten demonstrieren deshalb, dass der mHA2-Marker immunogen ist, wenn er im Kontext eines HIV-ähnlichen Partikels präsentiert wird, und dass Antikörper auch gegen die hauptsächlichen neutralisierenden Determinanten der V3-Schleifen aus unterschiedlichen HIV-Isolaten produziert werden.

Beispiel 5:

Dieses Beispiel beschreibt die Herstellung von HIV-ähnlichen Partikeln, welche antigenisch durch Mutationen an einer immundominanten Region von gp41 markiert werden.

Die Transmembrandomäne von gp160 (gp41) enthält eine immundominante Region, welche die Aminosäuresequenz LGIWGCSGKLIC (SEQ. ID. Nr.: 28) enthält, und Antikörper, welche diese Sequenz erkennen, sind in allen HIV-1-infizierten Individuen vorhanden. Tatsächlich wird die Detektion von Antikörpern, die für diese immundominante Region spezifisch sind, für die klinische Diagnose von HIV-1-Infektion verwendet. Solche Antikörper, die für diese immundominante Region spezifisch sind, werden für die klinische Diagnose von HIV-1-Infektion verwendet. Derartige Antikörper neutralisieren allerdings HIV-1 im Allgemeinen nicht. HIV-ähnliche Partikel, welche antigenisch von Wildtyp-HIV-1 unterscheidbar sind, wurden daher durch Mutagenese der immundominanten Region hergestellt. Mutanten der immundominanten Region, welche nicht von Serum aus HIV-Infektions-Patienten erkannt werden, wurden durch Erkennung von Peptiden, welche die Mutantensequenz enthalten, mit solchen Seren, wie gezeigt in der Tabelle 3, identifiziert. Mutationen wurden durch ortsspezifische Mutagenese unter Verwendung eines SculptureTM-in-vitro-Mutagenese-System-Kits, hergestellt von Amersham Life Science, Amersham International PLC, eingebracht. Ein SalI-BamHI-DNA-Fragment aus p83-19, enthaltend die Hüllen-codierende Sequenz, wurde in M13 subkloniert und Oligonukleotide, enthaltend DNA, spezifizierend die Mutationen, welche in Tabelle 3 gezeigt sind, wurden verwendet, um die passenden Mutationen an der immundominanten Region innerhalb von gp41 zu erzeugen, um die Konstrukte smIDR, Klon 4 und Klon 16 herzustellen. Jedes der Konstrukte wurde in VERO-Zellen transfiziert, um Retrovirusähnliche Partikel herzustellen, mittels Immunoblotting. Diese Retrovirus-ähnlichen Partikel wurden hinsichtlich der Expression von Hüll-Glykoproteinen gp120 und gp160 und gp41 analysiert. Alle von diesen Glykoproteinen waren in den verschiedenen Retrovirus-ähnlichen Partikeln vorhanden. Insbesondere wurde Klon 4, welcher die Aminosäure-Ersetzungen SGK -> AFR in der immundominanten Region von gp41 aufweist, ausgewählt.

ZUSAMMENFASSUNG DER BESCHREIBUNG

In der Zusammenfassung dieser Offenbarung stellt die vorliegende Erfindung gewisse nicht-infektiöse, nicht-replizierende HIV-ähnliche Partikel und Nukleinsäuremoleküle, welche diese codieren, zum Beispiel als immunogene Präparate, nützlich zur Impfung, Erzeugung von HIV-spezifischen Antiseren und als Antigene in diagnostischen Verfahren und Kits, bereit. Die HIV-ähnlichen Partikel können nicht-infektiös gemacht worden sein durch Modifikationen an den pol- und/oder gag-Genprodukten. Besondere HIV-ähnliche Partikel enthalten nicht-retrovirale antigene Marker.

LITERATUR-BEZUGSTELLEN

  • 1. Rovinski, B., Haynes, J.R., Cao, S.X., James, O., Sia, C., Zolla-Pazner, S., Matthews, T.J. und Klein, M. (1992) J. Virol., 66, 4003-4012.
  • 2. Wain-Hobson, S., Sonigo, P., Danos, O., Col, S. und Alizon, M. (1985) Cell, 40, 9-17.
  • 3. Myers, G., Berzofsky, J.A., Rabson, A.B., Smith, T.F. und Wong-Staa1, F.(Hrsg.) (1990) Human retroviruses and AIDS. Theoretical Biology and Biophysics, Group T-10. Los Alamos National Laboratory, Los Alamos, N.Mex.
  • 4. Alizon, M., Sonigo, P., Barre-Sinoussi, F., Chermann, J.C., Tiollais, P., Montagnier, L. und Wain-Hobson, S. (1984) Nature, 312, 757-780.
  • 5. Min Jou, W., Verhoeyen, M., Devos, R., Saman, E., Fang, R., Huylebroeck, D. und Fiers, W. (1980) Cell, 19, 683-696.
  • 6. Westhof, E., Altschuh, D., Moras, D., Bloomer, A.C., Mondragon, A., Klug, A. und Van Regenmortel, M.H. (1984) Nature, 311, 123-126.
  • 7. Trifilleff, E., Dubs, M.C. und Regenmertel, M.H.V. (1991) Mol. Immunol., 28, 889-896.
  • 8. Ullmer, Current Opinion, Invest. Drugs, 1993, 2: 983-989.
  • 9. Skinner, M.A., A.J. Langlois, C.B. McDanal, J.S. McDougal, D.P. Bolognesi und T. J. Matthews, 1988, J. Virol. 62: 4195-4200.


Anspruch[de]
Nicht-infektiöses Humanes-Immundefizienz-Virus (HIV)-ähnliches Partikel, welches eine Baugruppe aus folgendem umfasst:

(a) ein HIV-env-Genprodukt;

(b) ein HIV-pol-Genprodukt; und

(c) ein HIV-gag-Genprodukt; und gekennzeichnet durch:

(d) mindestens einen antigenen Marker, welcher nicht-HIV-retroviral ist und in der Lage ist, eine Immunantwort hervorzurufen.
HIV-ähnliches Partikel, wie beansprucht in Anspruch 1, wobei der mindestens eine antigene Marker nicht-retroviral ist. HIV-ähnliches Partikel, das in Anspruch 1 beansprucht ist, wobei der mindestens eine antigene Marker innerhalb des gag-Genprodukts enthalten ist, um ein Hybrid-gag-Genprodukt zu bilden, welches die Partikelbildungs-Eigenschaften von unmodifiziertem gag-Genprodukt aufweist. HIV-ähnliches Partikel, das in Anspruch 3 beansprucht ist, wobei der mindestens eine antigene Marker in das gag-Genprodukt an einer antigenisch aktiven Insertionsstelle inseriert ist. HIV-ähnliches Partikel, das in Anspruch 4 beansprucht ist, wobei die Insertionsstelle zwischen den Aminosäureresten 210 und 211 des gag-Genprodukts des HIV-1-LAI-Isolates oder der entsprechenden Stelle von anderen retroviralen gag-Genprodukten lokalisiert ist. Nicht-infektiöses Humanes-Immundefizienz-Virus (HIV)-ähnliches Partikel, das durch eine Baugruppe aus folgendem gekennzeichnet ist:

(a) ein modifiziertes HIV-env-Genprodukt, in welchem die endogene Verankerungs-Funktion durch eine unterschiedliche antigene Ankersequenz, welche funktionsfähig an das env-Genprodukt geknüpft ist, ersetzt worden ist, um das env-Genprodukt an dem HIV-ähnlichen Partikel zu verankern;

(b) ein HIV-pol-Genprodukt; und

(c) ein HIV-gag-Genprodukt.
HIV-ähnliches Partikel, das in Anspruch 6 beansprucht ist, wobei die Ankersequenz wenigstens einen Teil einer Transmembrankomponente eines Membran-überspannenden Proteins umfasst. HIV-ähnliches Partikel, das in Anspruch 7 beansprucht ist, wobei das Membran-überspannende Protein ein Glycoprotein ist. HIV-ähnliches Partikel, das in Anspruch 6 beansprucht ist, wobei die Ankersequenz in das env-Genprodukt angrenzend an und stromaufwärts von funktionellen Spaltungsstellen des env-Genprodukts inseriert ist. HIV-ähnliches Partikel, beansprucht in Anspruch 9, wobei die Ankersequenz zwischen den Aminosäureresten 507 und 508 des env-Genprodukts des HIV-1-Isolates LAI oder der entsprechenden Lokalisierung von anderen HIV-env-Genprodukten inseriert ist. HIV-ähnliches Partikel, das in Anspruch 10 beansprucht ist, wobei das HIV aus der Gruppe gewählt wird, welche aus HIV-1 und HIV-2 besteht. HIV-ähnliches Partikel von mindestens einem der Ansprüche 1 bis 11, wobei wenigstens eine Modifikation an dem pol-Genprodukt vorgenommen worden ist, um Reverse-Transkriptase-Aktivität und Integrase-Aktivität des pol-Genprodukts im Wesentlichen zu eliminieren. HIV-ähnliches Partikel, das in Anspruch 12 beansprucht wird, wobei das wesentliche Eliminieren von Reverse-Transkriptase-Aktivität des pol-Genprodukts durch Deletion mindestens eines Teils davon, welcher zur Reverse-Transkriptase-Aktivität beiträgt, bewirkt wird. HIV-ähnliches Partikel, beansprucht in Anspruch 12, wobei das wesentliche Eliminieren von Integrase-Aktivität des pol-Genprodukts durch Deletion mindestens eines Teils davon, welcher zur Integrase-Aktivität beiträgt, bewirkt wird. Nukleinsäuremolekül, das ein nicht-infektiöses Humanes-Immundefizienz-Virus (HIV)-ähnliches Partikel codiert, welches gekennzeichnet ist durch:

ein modifiziertes HIV-Genom, das hinsichtlich Long-Terminal-Repeats defizient ist und HIV-gag-, pol- und -env-Gene in ihrer natürlichen genomischen Anordnung und ein Segment enthält, welches mindestens einen antigenen Marker codiert, der nicht-HIV-retroviral ist und in der Lage ist, eine Immunantwort hervorzurufen.
Nukleinsäuremolekül, wie beansprucht in Anspruch 15, wobei der mindestens eine antigene Marker nicht-retroviral ist. Nukleinsäuremolekül, das in Anspruch 15 beansprucht ist, wobei das Segment, welches den mindestens einen antigenen Marker codiert, innerhalb des gag-Gens enthalten ist, um ein modifiziertes gag-Gen vorzusehen, das ein Hybrid-gag-Genprodukt codiert, welches die Partikelbildungs-Charakteristika von unmodifiziertem gag-Genprodukt aufweist. Nukleinsäuremolekül, beansprucht in Anspruch 17, wobei das Segment, welches den mindestens einen antigenen Marker codiert, in das gag-Gen inseriert ist, um den antigenen Marker an einer antigenisch aktiven Insertionsstelle in dem Hybrid-gag-Genprodukt vorzusehen. Nukleinsäuremolekül, beansprucht in Anspruch 18, wobei das Segment, welches den mindestens einen antigenen Marker codiert, an einer Insertionsstelle inseriert ist, welche an der PstI-Stelle an Nukleotid 1415 des gag-Gens von HIV-1-LAI-Isolat oder der entsprechenden Stelle anderer HIV-gag-Gene lokalisiert ist. Nukleinsäuremolekül, das ein nicht-infektiöses Humanes-Immundefizienz-Virus (HIV)-ähnliches Partikel codiert, welches gekennzeichnet ist durch:

ein modifiziertes HIV-Genom, das hinsichtlich Long-Terminal-Repeats defizient ist und HIV-gag-, pol- und env-Gene enthält, welche modifiziert sind, um darin ein Segment vorzusehen, welches eine antigene Ankersequenz codiert, um env-Genprodukt an dem HIV-ähnlichen Partikel zu verankern, wobei das modifizierte env-Gen ein modifiziertes env-Genprodukt codiert, in welchem die endogene Verankerungsfunktion von env durch die antigene Ankersequenz ersetzt worden ist.
Nukleinsäuremolekül, beansprucht in Anspruch 20, wobei das Segment, welches die Ankersequenz codiert, mindestens einen Teil einer Transmembrankomponente eines Membran-überspannenden Proteins codiert. Nukleinsäuremolekül, das in Anspruch 21 beansprucht wird, wobei das Membranüberspannende Protein ein Glycoprotein ist. Nukleinsäuremolekül, das in Anspruch 20 beansprucht wird, wobei das Segment, welches die Ankersequenz codiert, in dem env-Genprodukt angrenzend an und stromaufwärts von Nukleotid, codierend funktionelle Spaltungsstellen des env-Genprodukts, lokalisiert ist. Nukleinsäuremolekül, das in Anspruch 23 beansprucht wird, wobei das Segment, welches die Ankersequenz codiert, zwischen den Nukleotiden 7777 und 7778 des env-Gens des HIV-1-LAI-Isolates oder der entsprechenden Lokalisierung von anderen HIV-env-Genprodukten lokalisiert ist. Nukleinsäuremolekül, das in mindestens einem der Ansprüche 15 bis 24 beansprucht wird, wobei das modifizierte HIV-Genom hinsichtlich einer Primer-Bindungsstelle defizient ist. Nukleinsäuremolekül, beansprucht in mindestens einem der Ansprüche 1 bis 25, wobei das HIV aus der Gruppe gewählt wird, welche aus HIV-1 und HIV-2 besteht. Nukleinsäuremolekül, beansprucht in mindestens einem der Ansprüche 15 bis 26, wobei mindestens ein Codon in dem pol-Gen mutiert worden ist, um Reverse-Transkriptase-Aktivität und Integrase-Aktivität des pol-Genprodukts im Wesentlichen zu eliminieren. Nukleinsäuremolekül, beansprucht in mindestens einem der Ansprüche 15 bis 27, wobei das Nukleinsäuremolekül ein DNA-Molekül umfasst, welches die charakteristischen genetischen Elemente enthält, welche in einem Fragment von SacI (678) bis XhoI (8944) des Genoms des HIV-1-LAI-Isolates vorhanden sind. Nukleinsäuremolekül, beansprucht in mindestens einem der Ansprüche 15 bis 28, ohne eine Primer-Bindungsstelle und/oder ein RNA-Verpackungssignal. Immunogene Zusammensetzung, die in der Lage ist, eine hinsichtlich Humanem-Immundefizienz-Virus (HIV) spezifische Immunantwort und eine spezifische Immunantwort gegen einen nicht-retroviralen Marker hervorzurufen, umfassend das HIV-ähnliche Partikel, beansprucht in mindestens einem der Ansprüche 1 bis 14, oder das Nukleinsäuremolekül, beansprucht in mindestens einem der Ansprüche 15 bis 29, und einen Träger dafür. Verfahren zur Identifizierung von Antiserum, das mittels Immunisierung mit der immunogenen Zusammensetzung von Anspruch 30 erzeugt wurde, welches gekennzeichnet ist durch:

Nachweisen von für den antigenen Marker spezifischen Antikörpern in dem Antiserum.






IPC
A Täglicher Lebensbedarf
B Arbeitsverfahren; Transportieren
C Chemie; Hüttenwesen
D Textilien; Papier
E Bauwesen; Erdbohren; Bergbau
F Maschinenbau; Beleuchtung; Heizung; Waffen; Sprengen
G Physik
H Elektrotechnik

Anmelder
Datum

Patentrecherche

Patent Zeichnungen (PDF)

Copyright © 2008 Patent-De Alle Rechte vorbehalten. eMail: info@patent-de.com