PatentDe  


Dokumentenidentifikation DE69837012T2 29.11.2007
EP-Veröffentlichungsnummer 0001034000
Titel Herstellung von Impfstoffen zur Vorbeugung von Pathogenen Zuständen einer HIV retroviralen Infektion
Anmelder Mymetics S.A., Saint-Genis-Laval, FR
Erfinder SERRES, Pierre-Francois, F-69230 Saint-Genis-Laval, FR;
GEOURJON, Christophe, F-69007 Lyon, FR;
DELEAGE, Gilbert, F-69008 Lyon, FR;
COMBET, Christophe, F-42100 Saint-Etienne, FR
Vertreter TER MEER STEINMEISTER & Partner GbR Patentanwälte, 81679 München
DE-Aktenzeichen 69837012
Vertragsstaaten AT, BE, CH, CY, DE, DK, ES, FI, FR, GB, GR, IE, IT, LI, LU, MC, NL, PT, SE
Sprache des Dokument FR
EP-Anmeldetag 17.11.1998
EP-Aktenzeichen 989556733
WO-Anmeldetag 17.11.1998
PCT-Aktenzeichen PCT/FR98/02447
WO-Veröffentlichungsnummer 1999025377
WO-Veröffentlichungsdatum 27.05.1999
EP-Offenlegungsdatum 13.09.2000
EP date of grant 31.01.2007
Veröffentlichungstag im Patentblatt 29.11.2007
IPC-Hauptklasse A61K 39/21(2006.01)A, F, I, 20051017, B, H, EP
IPC-Nebenklasse C12N 15/48(2006.01)A, L, I, 20051017, B, H, EP   C07K 16/10(2006.01)A, L, I, 20051017, B, H, EP   

Beschreibung[de]

Die vorliegende Erfindung betrifft ein Verfahren zur Gewinnung von Impfstoffen, die zur Vorbeugung der pathogenen Wirkungen, die mit Retrovirusinfektionen verknüpft sind, am Menschen und an Wirbeltieren geeignet sind.

Die mit einer Retrovirusinfektion verbundenen pathogenen Wirkungen sind äußerst schädliche Effekte, welche onkogene oder immunsuppressive Effekte einschließen, welche durch Eindringen eines Retrovirus in einen Wirtsorganismus (Säuger, Vogel oder auch Fisch) ausgelöst werden, gefolgt von einem Eindringen und der Vermehrung des Retrovirus in die Zellen des Wirts, welche die Targetzellen oder Zielzellen des Retrovirus sind, das heißt Zellen, in welche das Virus eindringen kann.

Die Retroviren werden so bezeichnet, weil sie die Fähigkeit besitzen, aufgrund eines Enzyms, welches inverse Transkriptase genannt wird, eine Transkription von RNA in DNA zu bewirken, wobei festzuhalten ist, dass bei den lebenden Wesen die genetische Information üblicherweise von der DNA der Chromosomen über die Messenger-RNA zu Proteinen führt.

In der Familie der Retroviren unterscheidet man drei Unterfamilien: die Onkoviren, die Lentiviren und die Spumaviren.

Die Onkoviren sind Retroviren, die so bezeichnet werden, da sie mit Krebserkrankungen und bösartigen Infektionen assoziiert werden können. Man kann beispielsweise die leukämogenen Viren nennen (wie das Geflügelleukämie-Virus (ALV), das Mausleukämie-Virus (MULV), welches auch als Moloney-Virus bezeichnet wird, das Katzenleukämie-Virus (FELV), die menschlichen Leukämieviren, wie HTLV1 und HTLV2, das Affenleukämie-Virus oder STLV, das Rinderleukämie-Virus (oder BLV), die Onkoviren des Typs D der Primaten, die Onkoviren des Typs B, welche Mammatumore induzieren, oder Onkoviren, welche einen schnellen Krebs verursachen (wie das Rous-Sarkomvirus oder RSV); siehe beispielsweise STEHELIN et al., J. Mol. Biol., 101 (1976), 349–365).

Die Lentiviren werden so bezeichnet, weil sie für pathologische Zustände mit langsamer Entwicklung verantwortlich sind, welche sehr häufig zu immunsuppressiven Phänomenen Anlass geben, einschließlich AIDS.

Die beigefügte Tabelle 1 verdeutlicht beispielhaft die Erkrankungen, die mit bestimmten Lentiviren verknüpft sind sowie die wesentlichen Targetzellen dieser Lentiviren.

Die Spumaviren zeigen eine sehr geringe Spezifität für einen gegebenen Zelltyp oder eine gegebene Spezies und sie sind häufig mit immunsuppressiven Phänomen verknüpft, was beispielsweise der Fall ist bei dem Affen-Spumavirus (oder SFV).

Eines der Ziele der vorliegenden Erfindung besteht in der Bereitstellung von Impfverfahren und Impfprodukten, zur wirksamen Vorbeugung der pathogenen Wirkungen, einschließlich der onkogenen oder immunsuppressiven Wirkungen, die mit der Infektion eines Wirtsorganismus durch ein Retrovirus verbunden sind.

Die mit der Infektion verknüpfte Immunsuppression wurde für eine sehr große Vielzahl von Retroviren festgestellt und sie kann als eine pathogene Konstanz der Retrovirusinfektion angesehen werden; siehe insbesondere BENDINELLI et al., Advances in Cancer Research, 45 (1985), 125–181. Dies trifft insbesondere auf Lentivirus-Infektionen zu. Dies ist auch der Fall bei einer erheblichen Anzahl von Onkovirus-Infektionen, siehe beispielsweise P. SONIGO in dem Werk "SIDA et infection par HIV", MONTAGNIER et al. (Médecine Science Flammarion) (1989), Seiten 113–122.

Zur Vorbeugung der pathogenen Wirkungen von Retrovirus-Infektionen wurden viele menschliche und tierische Impfstoffe untersucht, wobei sich als allgemeine Regel diese Impfstoffe als wenig wirksam oder unwirksam erwiesen haben. Insbesondere im Bereich des menschlichen oder tierischen AIDS musste 14 Jahre nach der Entdeckung des HIV-Virus (BARRE-SINOUSSI et al., Science, 220 (1983), 860–871) festgestellt werden, dass es noch nicht gelungen ist, einen Impfstoff aufzufinden, der in wirksamer Weise eine postvakzinale HIV- oder SIV-Infektion zu bekämpfen; siehe beispielsweise LINHART et al., AIDS Research and Human Retroviruses, 13 (1997), 593–599); VOGT et al., Vaccine, 13 (1995), 202–208; und LETVIN et al., J. Virol., 69 (1995), 4569–4571).

Die Mehrzahl der verwendeten Impfpräparate umfasst Hüllproteine des Retrovirus in unterschiedlichen Formen, beispielsweise aktivierte Viren, Hüllproteine, wie die Proteine gp 120 und gp 160 des HIV-Virus (siehe insbesondere G. J. GORSE, Vaccine, 10 (1992), 383–388), Virenkerne mit Hüllproteinen oder Hüllproteine, die mit verschiedenen Vektoren kombiniert sind (chimäre Viren, Bakterien); siehe J. A. Levy, Trans. Med. Rev., 2 (1988), 265–271 und Microbiol. Rev., 57 (1993), 183–289, insbesondere Seite 247.

Andere Präparate verwenden Fragmente der Hülle des Retrovirus oder immunodominierende Peptide, die aus den Hüll-Glykoproteinen stammen, wobei diese Peptide in unterschiedlichen Formen eingesetzt werden (Lipopeptide, Peptide, die an einen Proteinträger gebunden sind), um sie immunogen zu machen; siehe insbesondere Eriksson et al., Vaccine, 11 (1993), 859–865.

Die in klassischer Weise beschriebenen Impfstrategien, beispielsweise im Bereich der AIDS-Erkrankungen beim Menschen, Affen oder Katzen, sehen vor, dass die konservierten und immunodominierenden Epitope der Hüllproteine nicht modifiziert werden, was vollständig logisch zu sein scheint. In der Tat sind diese konservierten Epitope verschiedenen Virusstämmen gemeinsam, was im Hinblick auf die Entwicklung eines Impfstoffs günstig ist und eine Immunantwort auslösen kann, die gegen eine Vielzahl von Stämmen gerichtet ist. Andererseits werden diese immunodominierenden Epitope aufgrund des Impf- und Infektionsprozesses von dem zellulären oder humoralen Immunsystem gut erkannt und darüber hinaus stellen sie häufig Neutralisationsstellen dar; siehe beispielsweise HO et al., J. Virol., 61 (1987), 2024–2028; JOHNSON et al., J. Exp. Med., 175 (1992), 961–971; SHAFFERMAN et al., P.N.A.S. U.S.A., 88 (1991), 7126–7130; und HAMMOND et al., J. Immunol., 146 (1991), 1470–1477.

Das Verfahren der vorliegenden Erfindung besteht nun darin, im Gegensatz dazu die konservierten und immunodominierenden Epitope bestimmter Virus-Hüllproteine zu modifizieren, um in dieser Weise zu einem wirksamen Impfstoff zu gelangen.

In der Tat haben die Autoren der vorliegenden Erfindung erkannt, dass konservierte und immunodominierende Bereiche der Hülle des Retrovirus der Ausgangspunkt für schädliche Autoimmun-Phänomene sein können. Beispielsweise wurde im Fall des menschlichen AIDS beobachtet, dass bestimmte konservierte und immunodominierende Bereiche der Hülle des HIV-Virus in der dreidimensionalen Struktur und/oder bei Kreuzreaktionen Analogien zeigen mit bestimmten Bereichen mindestens eines Proteins des menschlichen Immunsystems, derart, dass die Verabreichung eines Virusproteins, welches diese intakten Bereiche enthält, als Impfstoff zu einer Immunantwort führt, welche der Ursprung ist von schädlichen Autoimmunreaktionen, was zu einem Versagen der Impfung führt.

Am Ursprung der vorliegenden Erfindung findet man einerseits die oben erwähnte Beobachtung, dass die konservierten und immunodominierenden Bereiche bestimmter Retroviren, die üblicherweise in Impfpräparaten vorhanden sind, tatsächlich in einer Vielzahl von Fällen die Bereiche sind, welche schädliche Autoimmunreaktionen verursachen, da sie Analogien in ihrer dreidimensionalen Struktur und/oder bei Kreuzreaktionen zeigen mit bestimmten Proteinen des Wirts des Virus. Am Ursprung der vorliegenden Erfindung findet man weiterhin andererseits die Beobachtung, dass die genannten Wirtsproteine die gleiche Targetzelle oder die gleichen Targetzellen benützen, wie die genannten Retroviren. Die Gesamtheit dieser von den Autoren der vorliegenden Erfindung gemachten Beobachtungen hat sie zu der Erkenntnis geführt, dass die Hüllproteine von Retroviren und die Wirtsproteine, welche Analogien in der dreidimensionalen Struktur und/oder bei Kreuzreaktionen aufweisen, sich bei einer Vielzahl von Fällen an die gleichen Targetzellen binden und auf diesen Targetzellen gemeinsame Membranrezeptoren besitzen.

Ein Protein zeigt eine Kreuzreaktion mit einem anderen Protein, wenn es möglich ist, durch Immunisierung in vivo oder in vitro mit Hilfe eines der genannten Proteine eine Immunantwort auszulösen, welche gegen das andere Protein gerichtet ist, beispielsweise wenn diese Immunisierung eine humorale Antwort induziert (die als Typ B bezeichnet wird) und es ermöglicht, mindestens einen monoklonalen Antikörper zu selektionieren, der dazu in der Lage ist, das andere Protein zu erkennen, oder wenn ein und dieselbe durch eines der Proteine in vitro induzierte zelluläre Immunantwort (vom Typ T) die beiden Proteine erkennt bei bekannten Tests für den Nachweis einer Immunantwort des Typs T, wie beispielsweise die in vitro durchgeführten Cytotoxizitätstests. Es ist bekannt, dass der Begriff "Immunisierung" den Prozess der Induzierung einer Immunantwort als Folge einer Reizung ist, durch Inkontaktbringen in vivo oder in vitro von immunokompetenten Zellen eines Wirts mit einem Antigen, und dass eines der Ziele der Verabreichung eines Impfstoffs genau die Erzielung einer solchen Immunisierung ist.

Die Erfindung betrifft demzufolge ein Verfahren zur Gewinnung eines Impfstoffs gegen die pathogenen Wirkungen, die mit der Infektion eines tierischen oder menschlichen Wirts durch ein HIV-Retrovirus, das dazu in der Lage ist, in eine Targetzelle des Wirts einzudringen, verbunden sind, welche Targetzelle einen Membran-Rezeptor für das Wirts-Interleukin-2 (IL-2)-Protein aufweist, gemäß welchem Verfahren man ein impfendes Mittel bildet auf der Grundlage eines Polypeptids, das mindestens einen Teil des Hüllproteins gp41 eines pathogenen Stamms des Retrovirus umfasst, und welches Polypeptid in einer modifizierten Form hergestellt wird, mit der Maßgabe, dass:

  • – der Teil des Hüllproteins gp41 aus jenen ausgewählt wird, die mindestens ein Fragment eines immunodominierenden Bereichs des Hüllproteins gp41 umfassen, welches Fragment mindestens eine Aminosäure enthält, die eine Aminosäure aus dem immunodominierenden Bereich ist und die in dem pathogenen Stamm vorhanden ist,
  • – das Polypeptid in nicht-modifiziertem Zustand eine Immunantwort induziert, die gleichzeitig gegen den immunodominierenden Bereich und gegen das Wirts-IL-2-Protein gerichtet ist,
  • – und das modifizierte Polypeptid aus jenen ausgewählt ist, die eine Immunantwort induzieren, welche gegen den immunodominierenden Bereich, jedoch nicht gegen das Wirts-IL-2-Protein gerichtet ist.

Bei der oben angegebenen Definition des erfindungsgemäßen Verfahrens basiert das impfende Mittel "auf der Grundlage" eines modifizierten Polypeptids. Dies bedeutet, dass das impfende Mittel ein solches modifiziertes Polypeptid umfasst, bedeutet jedoch nicht, dass das impfende Mittel notwendigerweise ausschließlich polypeptidischer Natur ist. In der Tat kann das genannte Polypeptid in diesem impfenden Mittel gegebenenfalls in an sich bekannter Weise mit irgendeinem biologisch verträglichen Molekül, welches beispielsweise aus Polymeren, Lipiden, Peptiden (einschließlich Lipopeptide, Glykopeptide und Proteine), Nucleinsäuren, Oligosaccharide etc., verbunden (insbesondere kovalent gebunden) oder assoziiert sein. Das biologisch verträgliche Molekül kann insbesondere als Träger eines polypeptidischen immunogenen Mittels dienen. Es kann auch dazu dienen, die Konformation des Polypeptids zu modifizieren, wobei in diesem letzteren Fall das Molekül als ein Substituent angesehen werden muss, der den Aminosäurerest, an den es gebunden ist, modifiziert, wodurch der Substituent in dieser und in definitiver Weise die Antigenizität des Polypeptids, dem dieser Aminosäurerest angehört, modifiziert.

Das erfindungsgemäße Verfahren kann mindestens eine vorausgehende Phase der Suche umfassen, eine Stufe, die darin besteht, die (nicht-modifizierten) Polypeptide auszuwählen, welche mindestens einen Teil, wie er oben definiert worden ist, des Virus-Hüllproteins gp41 eines pathogenen Stamms des Retrovirus HIV umfassen. Dieser Teil des Proteins, welcher mindestens ein immunogenes Fragment eines immunodominierenden Bereichs umfasst, ist derart ausgebildet, dass das (nicht-modifizierte) Polypeptid dazu in der Lage ist, eine Immunantwort zu induzieren, die gleichzeitig gegen das Virusprotein (genauer gegen das Fragment des immunodominierenden Bereichs, der in dem genannten Teil enthalten ist) und gegen das Wirtsprotein IL-2 gerichtet ist, und es ist die Existenz einer solchen Immunantwort, die gegen das Virus-Hüllprotein gp41 und gegen das Wirtsprotein IL-2 gerichtet ist, welche im Rahmen der vorliegenden Erfindung den pathogenen Charakter eines Virusstamms definiert. Man kann in dieser Weise (nicht-modifizierte) Polypeptide, die ein solches Fragment enthalten, selektionieren.

Ein Polypeptidfragment wird als immunogen bezeichnet, wenn die Immunisierung eines Wirts in vivo oder in vitro mit dem genannten Fragment, das gegebenenfalls an einen geeigneten Träger (wie ein Protein, ein Lipid oder ein Polypeptid) gebunden ist, zu einer Immunantwort vom Typ B und/oder vom Typ T führt, die gegen das Polypeptidfragment gerichtet ist.

Wenn im Rahmen der vorliegenden Erfindung von einer Immunantwort die Rede ist, handelt es sich, wenn nichts anderes angegeben wird, um eine Immunantwort eines Wirbeltiers als Folge einer in vitro- oder in vivo-Immunisierung.

Das erfindungsgemäße Verfahren kann weiterhin mindestens eine Stufe umfassen, die darin besteht, in der nachfolgend angegebenen Weise ein in dieser Weise ausgewähltes Polypeptid zu modifizieren und aus dem in dieser Weise modifizierten Polypeptiden mindestens ein modifiziertes Polypeptid auszuwählen, welches eine Immunantwort induziert, die gegen das Virus-Hüllprotein gp41 und nicht gegen das Wirtsprotein IL-2 gerichtet ist.

Während somit der Stand der Technik, wie oben angegeben worden ist, lehrt, die konservierten und immunodominierenden Bereiche der Retrovirus-Hüllproteine nicht zu modifizieren, stellt das erfindungsgemäße Verfahren im Gegensatz dazu darauf ab, die Antigenizität der Epitope in der Weise zu modifizieren, dass man eine differenzierte Immunantwort gegenüber dem Virus-Hüllprotein und einem Wirtsprotein erhält.

Es ist bekannt, dass es zur Modifizierung der Antigenizität eines immunogenen Fragments eines Polypeptids möglich ist, das Polypeptid durch eine Mutation, die auf mindestens eine Aminosäure gerichtet ist, zu modifizieren. Was in diesem Zusammenhang unter einer "Mutation" zu verstehen ist, wird weiter unten definiert. Die mutierte Aminosäure kann in dem immunogenen Fragment angeordnet sein oder in einem äußeren Bereich des Polypeptids des Fragments. Es ist bekannt, dass die Modifizierung einer Aminosäure, die an der Außenseite eines Fragments vorliegt, die räumliche Struktur des Fragments und demzufolge seine Antigenizität beeinflussen kann; insbesondere konnte gezeigt werden, dass die Konformation eines Aminosäurerests in einem Peptid durch die Art der Aminosäurereste in den Positionen von +8 bis –8, bezogen auf diesen Aminosäurerest, beeinflusst werden kann; siehe beispielsweise GARNIER et al., J. Mol. Biol., 120 (1978), 97–120. Darüber hinaus hat die Art der Aminosäurereste weiterhin einen Einfluss, welcher Einfluss jedoch weder systematisch noch quantifizierbar ist ausgehend lediglich von der Kenntnis der betreffenden Peptidsequenz.

Eine mutierte Aminosäure kann demzufolge in dem modifizierten Polypeptid im Inneren oder im Äußeren des immunogenen Fragments vorliegen. Wenn sie im äußeren Bereich des immunogenen Fragments angeordnet ist, ist sie im allgemeinen von dem nächsten Ende des immunogenen Fragments in der Peptidkette um nicht mehr als acht (insbesondere nicht mehr als sieben) Aminosäurereste getrennt. Insbesondere ist eine erfindungsgemäß mutierte Aminosäure, die im äußeren Bereich des immunogenen Fragments vorliegt, im allgemeinen um nicht mehr als acht Aminosäurereste und insbesondere nicht mehr als sieben Aminosäurereste von der nächsten konservierten Aminosäure entfernt, die dem immunodominierenden Bereich angehört, von dem mindestens ein Fragment in dem nicht-modifizierten Polypeptid enthalten ist.

Das erfindungsgemäß modifizierte Polypeptid kann beispielsweise das vollständige Hüllprotein JP61 eines pathogenen HIV-Virenstamms sein, welches durch mindestens eine Mutation, wie oben angegeben, modifiziert ist. Das modifizierte Polypeptid kann auch ein Teil des Hüllproteins gp41 eines pathogenen HIV-Virenstamms sein, das durch mindestens eine in der oben angegebenen Weise beschriebene Mutation modifiziert ist, wobei der genannte Teil mindestens ein immunogenes Fragment der oben definierten Art umfasst. Das modifizierte Polypeptid kann weiterhin ein chimäres Protein sein, welches mindestens einen Teil des Hüllproteins gp41 des Teils des Hüllproteins, welches oben definiert worden ist und mindestens eine Mutation aufweist, umfasst.

Die oben gegebene Definition des erfindungsgemäßen Verfahrens impliziert, dass das verwendete Polypeptid mindestens einen Teil eines immunodominierenden und konservierten Bereichs eines Virus-Hüllproteins gp41 umfasst. In der vorliegenden Beschreibung bezeichnet man mit "konserviertem Bereich" einen Bereich, der gegebenenfalls auf einen einzigen Aminosäurerest reduziert ist, des Virusproteins, auf dem man für eine Vielzahl von gegebenen Virenstämmen (beispielsweise bei mindestens 6 Stämmen von etwa 10) ein oder mehrere identische oder funktionell analoge Aminosäuren findet, die in gleicher Position in den Peptidsequenzanordnungen des Proteins der verschiedenen Stämme angeordnet ist. Eine solche identische oder funktionell analoge Aminosäure wird als konservierte Aminosäure bezeichnet. Die Vorstellung der Konservierung von funktionell analogen Aminosäuren ist bekannt und es existiert eine Vielzahl von Substitutionsmatrizes, welche eine Quantifizierung dieser Vorstellung ermöglicht (M. O. Dayhoff et al., in: Atlas of Protein Sequence and Structure, Bd. 5, Suppl. 3 (1978), Kapitel 22 und 23).

Die konservierten Bereiche können in einfacher Weise bestimmt werden nach der Sequenzierung der Proteine von verschiedenen untersuchten Virusstämmen mit Hilfe von Multiple Alignment-Methoden der erhaltenen Sequenzen. Man kann hierzu beispielsweise das Programm Clustal-w (J. D. Thompson et al., Nucleic Acids Research, 22 (1994), 4673–4680) verwenden. Andererseits sind die Sequenzen der Proteine von verschiedenen Virusstämmen häufig über Datenbanken zugänglich. Beispielsweise enthält der Web-Server der Datenbank HIV von Los Alamos die Sequenzen HIV1 und HIV2, die regelmäßig aktualisiert werden. Die Internetadresse dieses Servers lautet wie folgt:

http://hiv-web.lanl.gov/HTML/sequences.html

Die beigefügten Tabellen 2a, 2b und 2c zeigen Beispiele von Sequenz-Alignments von Bereichen, die den homologen Hüll-Glykoproteinen des Bereichs 545–682 des Transmembran-Glykoproteins des HIV1-Virus (Datenbankeintrag: SWISSPROT ENV_HV1 BR) für HIV1 bzw. HIV2. Die letzte Zeile dieser Tabellen resümiert mit Hilfe von Symbolen den Grad der Homologie und demzufolge den beobachteten Konservierungsgrad. Das Symbol "*" steht für eine Alignment-Position, an der der gleiche Rest in sämtlichen Sequenzen vorhanden ist, das Symbol ":" definiert eine Position in dem Alignment, bei dem die in den verschiedenen Sequenzen vorhandenen Aminosäuren sehr ähnlich sind, das Symbol "." bedeutet, dass eine Position in dem Alignment, in dem die in den verschiedenen Sequenzen vorhandenen Aminosäuren ähnlich sind, und die Abwesenheit eines Symbols bedeutet, dass eine Position in dem Alignment, in dem die in den verschiedenen Sequenzen vorhandenen Aminosäuren wenig Ähnlichkeit aufweisen. Diese Symbolik wird von dem Alignment-Programm Clustal w (Version 1.7) benutzt.

In der vorliegenden Beschreibung bezeichnet man als immunodominierenden Bereich des Proteins eine Peptidsequenz, die in einer großen Vielzahl der Fälle (beispielsweise in mindestens 7 Fällen von etwa 10) eine humorale und/oder zellulare Antwort des Immunsystems gegen den genannten Bereich induziert, nach der Immunisierung mit einem Protein, welches die genannte Sequenz enthält oder mit einem Peptid, welches im wesentlichen die genannte Sequenz bildet.

Die Definition des erfindungsgemäßen Verfahrens bezieht sich auf Targetzellen oder Zielzellen eines Virus, welches Zellen sind, in deren Inneres das Virus einzudringen vermag. Die Targetzellen der Retroviren sind im allgemeinen bekannt. Die Viren besitzen die Fähigkeit, sich an die Zellen, die sie zu infizieren vermögen, zu binden. Man kann demzufolge mit Hilfe von in vitro durchgeführten Routineuntersuchungen gegebenenfalls die Targetzellen eines untersuchten Virus suchen.

Die Definition des erfindungsgemäßen Verfahrens bezieht sich weiterhin auf die Zellen eines Wirts, welche einen Membranrezeptor für ein Wirtsprotein IL-2 aufweisen. Die Zellen des Wirts, die einen Rezeptor für ein Wirtsprotein IL-2 aufweisen, sind häufig bekannt und wenn dies nicht der Fall sein sollte, ist es möglich, mit Hilfe von Routineuntersuchungen festzustellen, ob ein gegebenes Protein sich an einen bestimmten Zelltyp bindet. Man kann beispielsweise ein radioaktiv markiertes Protein verwenden und untersuchen, ob es sich an den genannten Zelltyp bindet. Man kann weiterhin untersuchen, ob das Protein sich an einen gegebenen Membranrezeptor bindet unter Verwendung einer Zelllinie, die mit Hilfe eines Gens transfektiert worden ist, welches den genannten Membranrezeptor exprimiert.

Im Rahmen der vorliegenden Erfindung wird angenommen, dass eine Immunantwort, beispielsweise eine Antikörperantwort, die man durch Immunisierung mit Hilfe eines nach dem erfindungsgemäßen Verfahren hergestellten modifizierten Polypeptids verursacht hat, gegen das Virus-Hüllprotein gp41 und nicht gegen das Wirtsprotein IL-2 gerichtet ist, wenn die erhaltenen Antikörper Affinitäten besitzen, die für das Wirtsprotein und für das Hüllprotein des Retrovirus einen deutlichen Unterschied aufweisen, der sich insbesondere in Unterschieden der Reaktivität manifestiert, die bei den ELISA-Tests als sehr signifikant angesehen werden, wie beispielsweise optische Dichten in einem Verhältnis von etwa 4 (oder mehr), was bedeutet, dass die beobachtete optische Dichte nach der Bindung der Antikörper an dem Virusprotein gp41 mehr als viermal größer ist als jene, die man bei der Bindung der Antikörper an das Wirtsprotein IL-2 beobachtet. In analoger Weise wird eine zelluläre Immunantwort als gegen das Hüllprotein gp41, jedoch nicht gegen das Wirtsprotein IL-2 gerichtet angesehen, wenn die in vitro-Immunisierung der immunokompetenten Zellen des Wirts mit dem Impfstoffkandidat zur Bildung von aktivierten Zellen führt, deren Reaktion gegenüber Zellen (welche transfektierte Zelllinien einschließen), die das Retrovirus-Hüllprotein exprimieren, signifikant höher ist als die Reaktion gegenüber Zellen, die das Wirtsprotein exprimieren, beispielsweise wenn im Fall der endgültigen optischen Messung oder bei dem endgültigen Auszählen der Radioaktivität (insbesondere die von den Targetzellen ausgestrahlte 51Cr-Radioaktivität) des angewandten Tests, oder bei der Bewertung mit Hilfe sämtlicher bekannter Methoden einer Zelllyse, die durch cytotoxische Zellen induziert wird, wobei das Ausmaß der Antworten in einem Verhältnis von etwa 4 (oder mehr) steht. Die angegebenen Kriterien ermöglichen mindestens eine erste Auswahl unter den untersuchten modifizierten Peptiden, wobei jedoch definitiv die Abwesenheit oder die Verminderung der pathogenen Wirkung als Folge der Suppression oder der Abschwächung (welche mit Hilfe jeglicher geeigneter Methoden nachgewiesen werden kann) der Immunantwort gegenüber dem Wirtsprotein das Kriterium der Auswahl der modifizierten Peptide darstellt, welche dazu geeignete sind, zufriedenstellende Impfmittel zu bilden.

Die immunodominierenden und konservierten Bereiche, deren Antigenizität erfindungsgemäß modifiziert werden soll, können in vitro mit Hilfe einer Kreuzreaktion vom Typ B und/oder vom Typ T mit dem Wirtsprotein IL-2 ausgewählt werden.

Man kann einen solchen immunodominierenden und konservierten Bereich auch unter Zellen auswählen, für die man zuvor eine Analogie der dreidimensionalen Struktur mit einem Bereich des Hüllproteins IL-2 festgestellt hat, welche Strukturanalogie mit Hilfe einer in vitro- und/oder in vivo-Kreuzreaktion festgestellt werden kann. Die dreidimensionale Strukturanalogie zwischen bestimmten Bereichen von zwei Proteinen bezieht sich auf äquivalente räumliche Anordnungen von Aminosäureresten, die ähnlich sind insbesondere im Hinblick auf ihre Seitenkette und/oder ihre analogen funktionellen chemischen Gruppen. Die dreidimensionalen Strukturen von Proteinen können mit Hilfe von kernmagnetischen Resonanzspektren (NMR) und/oder Röntgenbeugungsspektren bestimmt werden. Beispielsweise wurde die Struktur des Proteins gp41 von SIV mit Hilfe des NMR-Spektrums bestimmt (M. Caffrey et al., J. Mol. Biol., 271 (1997), 819–826). Andererseits ist es in bestimmten Fällen möglich, ein gutes Modell mit Hilfe von Molekularmodellisierungstechniken zu erhalten ausgehend von den Atomkoordinaten eines Proteins bekannter Struktur. Man kann hierzu beispielsweise das Molekularmodellprogramm X-plor verwenden (Referenz: "A system for X-ray crystallography and NMR, Version 3.1", Axel T. Brunger, Yale University Press (1992)).

Zur Untersuchung einer dreidimensionalen Strukturanalogie kann man beispielsweise bekannte Methoden der Visualisierung und Überlagerung der dreidimensionalen Struktur von biologischen Molekülen auf einem graphischen Bildschirm anwenden. Es existieren Rechenprogramme, welche die Visualisierung der dreidimensionalen Strukturen von Molekülen mit unterschiedlichen Wiedergabearten, die Berechnung von geometrischen Parametern (wie die Abstände, Winkel, etc.) und die objektive und quantitative Überlagerung mehrerer Molekülstrukturen ermöglichen (insbesondere die Programme RASMOL: R. A. Sayle und E. J. Milner-White, J. Mol. Biol., 247 (1995), 536–540 und ANTHEPROT: C. Geourjon und G. Deléage, J. Mol. Graph., 13 (1995), 209–212) sowie die Abschätzung der Zugängigkeit von Lösungsmitteln (siehe das bereits erwähnte Programm X-plor und CCP4: Collaborative Computational Project Number 4, Acta Cryst., D50 (1994), 760–763).

Für eine feinere Abschätzung dieser Strukturanalogien ist es nützlich, im Bereich einer jeden Aminosäure die funktionellen Gruppen zu berücksichtigen, die in analoger Weise an den beiden zu vergleichenden Proteinen vorhanden sind. Hierzu haben die Erfinder der vorliegenden Erfindung Methoden angewandt, welche die Berechnung der Moleküloberflächen ermöglichen mit dem Ziel, die funktionellen Eigenschaften zwischen zwei dreidimensionalen Strukturen zu vergleichen, wobei nicht nur die Aminosäuren in ihrer Globalität berücksichtigt werden, sondern auch insbesondere die funktionellen chemischen Gruppen jeder dieser Aminosäuren (beispielsweise: Amid-, Carboxyl-, Hydroxyl-, Sulfhydryl-, Aminfunktion, etc.). Man kann in dieser Weise in den zu vergleichenden Strukturen analoge Aminosäuren und nicht nur identische Aminosäuren berücksichtigen.

Ein Bereich eines Retrovirusproteins gp41 besitzt demzufolge eine dreidimensionale Strukturanalogie zu einem gegebenen Bereich eines Wirtsproteins IL-2, wenn die erwähnten Methoden in den zu vergleichenden Bereichen eine ähnliche räumliche Struktur bestimmter identischer oder funktionell analoger Aminosäuren nachzuweisen ermöglichen.

Es ist festzuhalten, dass die funktionell analogen und in ähnlicher Weise im Raum angeordneten Aminosäuren in ein und derselben Peptidkette relativ weit voneinander entfernt sein können. Die dreidimensionale Strukturanalogie zwischen zwei zu vergleichenden Proteinen kann auch die ähnliche Anordnung von identischen oder funktionell analogen Aminosäuren im Raum betreffen oder, wenn eines der Proteine oligomerisiert ist, können die in Rede stehenden Aminosäurereste auf verschiedenen Ketten des Oligomers vorliegen, während die Aminosäurereste des anderen Proteins, die an dieser Analogie beteiligt sind, auf ein und derselben Peptidkette dieses anderen Proteins vorliegen können.

Es ist besonders vorteilhaft, die Analogien der dreidimensionalen Struktur und/oder der Kreuzreaktionen mit den Bereichen des in Rede stehenden Wirtsproteins IL-2 im Hinblick auf die Bindung dieses Proteins an seinen Rezeptor zu untersuchen.

Zur Herstellung des modifizierten Polypeptids, welches das nach der vorliegenden Erfindung erhaltene impfende Mittel bildet, kann man bekannte Methoden der Peptidsynthese oder der Gentechnik anwenden. Man kann eine Polynucleotidsequenz, welche für mindestens einen Teil des Hüllproteins gp41 des Virus codiert, isolieren oder herstellen und man kann gewünschtenfalls in diesem Stadium Mutationen in die Nucleotidsequenz einführen, welche ein mutiertes Umsetzungsprodukt ergeben, welches das modifizierte Polypeptid darstellt. Man kann auch direkt eine modifizierte Polynucleotidsequenz synthetisieren, die eine oder mehrere Mutationen aufweist und für das modifizierte Polypeptid codiert. Die in dieser Weise erhaltenen mutierten Polynucleotidsequenzen werden in an sich bekannter Weise in einen geeigneten Vektor eingeführt und ermöglichen die Exprimierung des Polypeptids gegebenenfalls in modifizierter Form. Ein solcher Vektor ist beispielsweise E. coli, ein Baculovirus oder eine Säugerzelle. Man kann die Mutation auch an einem nicht-modifizierten Polypeptid durchführen, welches man mit Hilfe der oben angegebenen Methoden erhalten hat.

Im Rahmen der vorliegenden Erfindung bezeichnet man mit "Mutation" jede Modifizierung eines Bereichs (die gegebenenfalls auf einen einzigen Aminosäurerest reduziert ist) eines Polypeptids, mit Hilfe von physikalischen Methoden, chemischen Methoden (kovalente oder nicht-kovalente Modifizierung) und/oder biologische Methoden (Mutationen durch Substitution, Deletion und/oder Insertion einer oder mehrerer Aminosäuren), die zu einer Modifizierung des funktionellen Potentials des oder der konstitutiven Aminosäuren des Bereichs, der als "mutierter Bereich" bezeichnet wird, führen. Beispielsweise kann man Modifikationen durchführen, die zu einer Beseitigung, Einführung und/oder Modulierung von Eigenschaften von Disulfidbrücken, Wasserstoffbindungen, elektrostatischen Wechselwirkungen und/oder hydrophoben Wechselwirkungen, der Modifizierung der Fähigkeit eines Proteins einen Heterokomplex zu bilden, oder im Fall eines oligomeren Proteins zur Modifizierung des Oligomerisierungszustands oder der Stabilität des Oligomeren führen.

Die Modifizierung einer Aminosäure einer Polypeptidkette (einschließlich der Modifizierung einer endständigen Aminosäure des in Rede stehenden Polypeptids) kann die Konformation von in der Kette vorhandenen benachbarten Aminosäuren beeinflussen, einschließlich, wie oben erwähnt, der Konformation einer Aminosäure b, die von a durch eine Anzahl von Aminosäureresten, die bis zu sieben oder acht betragen kann, getrennt ist, und wenn die Aminosäure b Teil eines Epitops bildet, kann jede Modifizierung der Aminosäure a (insbesondere jede Hinzufügung eines Substituenten oder eine jede Modifizierung eines Substituenten) zu einer Modifizierung der Antigenizität des in Rede stehenden Epitops führen.

In der Phase der Suche von erfindungsgemäßen modifizierten Polypeptiden kann die Auswahl der zu mutierenden Aminosäuren und/oder die Auswahl der Mutationsmethoden beliebig begründet sein. Man kann insbesondere mindestens eine der nachfolgenden Modifizierungsmethoden anwenden:

  • 1) Den Ersatz einer oder mehrerer Aminosäuren mit einer hydrophoben Seitenkette (Beispiele: Ala, Leu, Val, Ile, Phe, Trp, Met, Tyr, Cys) durch eine oder mehrere Aminosäuren mit einer hydrophilen Seitenkette (Beispiele: Arg, Asp, Asn, Glu, Gln, Ser, Thr, His, Lys) oder mit einer indifferenten Seitenkette (Beispiele: Gly, Pro) oder umgekehrt;
  • 2) den Ersatz einer oder mehrerer Aminosäuren mit einer positiv geladenen Seitenkette (Beispiele: Arg, Lys, His) durch eine oder mehrere Aminosäuren mit einer negativ geladenen Seitenkette (Beispiele: Asp, Glu) oder neutraler Seitenkette und vice versa;
  • 3) die Einführung, Beseitigung und/oder Modifizierung einer oder mehrerer Disulfidbrücken;
  • 4) die Realisierung von Mimotopen, insbesondere durch Retro-Inversion erhaltene;
  • 5) den Ersatz, Beseitigung, Einführung und/oder andere Modifizierungen mindestens einer Aminosäure, die potentiell ein Donor oder Akzeptor von Wasserstoffbindungen ist;
  • 6) die Substitution, Beseitigung, Einführung und/oder andere Modifizierungen mindestens einer Aminosäure, die potentiell Donor oder Akzeptor von Ionenbindungen ist;
  • 7) die Veränderung der sterischen Hinderung durch Substitution, Beseitigung, Einführung und/oder andere Modifizierungen einer oder mehrerer Aminosäuren;
  • 8) die Verwendung von Aminosäuren, die nicht-natürlich in den Proteinen vorhanden sind;
  • 9) die Modifizierung der Glykosylierung (Bildung, Beseitigung oder Modifizierung von Glykosylierungsstellen und/oder deren assoziierten Zuckern).

Es versteht sich, dass die in dieser Weise erhaltenen modifizierten Polypeptide in der oben angegebenen Weise geprüft werden zur Selektion von modifizierten Polypeptiden, die eine Immunantwort induzieren, welche gegen das Hüllprotein gp41 und nicht gegen das Wirtsprotein IL-2 gerichtet ist.

Das erfindungsgemäße Verfahren kann auf die Herstellung von Impfstoffen, insbesondere gegen die folgenden Viren angewandt werden: HIV.

Die Erfindung betrifft weiterhin die Verwendung eines modifizierten Polypeptids der oben definierten Art für die Herstellung einer Impfzubereitung zur Vorbeugung der pathogenen Wirkungen, die mit der Infektion eines Wirts durch ein HIV-Retrovirus verbunden sind.

Die Erfindung betrifft weiterhin eine Impfzubereitung, die mit Hilfe des erfindungsgemäßen Verfahrens erhalten werden kann und die als Wirkstoff ein modifiziertes Polypeptid der oben beschriebenen Art enthält. Eine solche Zubereitung kann bei einem Impfverfahren verwendet werden, das darauf abzielt, den pathogenen Wirkungen von HIV-Retrovirus-Infektionen vorzubeugen, wobei dieses Verfahren im wesentlichen darin besteht, einem Wirbeltier, einschließlich einem Menschen, ein modifiziertes Polypeptid, wie es oben definiert ist, in einer ausreichenden Menge zur Erzielung einer solchen Impfwirkung zu verabreichen. Die Formulierung der Impfzubereitungen und das Verfahren zu ihrer Verabreichung sind an sich bekannt und werden hier nicht näher erläutert.

Die Erfindung betrifft weiterhin ein modifiziertes retrovirales Polynucleotid, welches für ein modifiziertes Polypeptid, wie es oben definiert worden ist, codiert. Das modifizierte Polynucleotid kann in der oben angegebenen Weise erhalten werden. Die Erfindung erstreckt sich auch auf einen Expressionsvektor, in den das genannte modifizierte Polynucleotid eingeführt worden ist, welcher Expressionsvektor damit in der Lage ist, das modifizierte Polypeptid zu exprimieren.

Das erfindungsgemäß erhaltene modifizierte Polypeptid kann auch als immunogenes Mittel dienen dadurch, dass es durch Immunisierung die Bildung von Antikörpern induziert, die insbesondere bei der Behandlung von Retrovirus-Infektionen geeignet sind und die Erfindung betrifft demzufolge auch die als Antwort auf die Immunisierung von Tieren (einschließlich Menschen) in vivo oder in vitro mit Hilfe eines impfenden Mittels, welches ein modifiziertes Polypeptid, wie es oben beschrieben worden ist, erhaltenen Antikörper. Die erfindungsgemäßen Antikörper sind insbesondere gereinigte polyklonale Antikörper oder monoklonale Antikörper, welche die Eigenschaft besitzen, das Retrovirus-Hüllprotein zu erkennen ohne das Wirtsprotein zu erkennen. Die Reinigung der polyklonalen Antikörper und die Selektion der monoklonalen Antikörper kann mit Hilfe des Virusproteins und des Wirtsproteins erfolgen in der Weise, dass nur die Antikörper gewonnen werden, welche das Virusprotein und nicht das Wirtsprotein erkennen. Die erfindungsgemäßen Antikörper können insbesondere bei der vorbeugenden Behandlung von Infektionen verwendet werden, die an dem betreffenden Wirt durch das Retrovirus, gegen das sie gerichtet sind, verursacht werden. Die Dosierung ist die für Antikörper übliche Dosierung. Die solche Antikörper enthaltenden pharmazeutischen Zubereitungen sind ebenfalls Gegenstand der Erfindung.

Die Beispiele verdeutlichen die Erfindung.

BEISPIEL 1

Im folgenden sei erläutert, wie die Autoren der vorliegenden Erfindung die strukturellen und antigenen Analogien zwischen einem Virus-Hüllprotein, das heißt dem Protein gp41 des HIV1 und eines Cytokins, das heißt humanes Interleukin-2 (abgekürzt: IL-2) festgestellt haben.

Es sei bemerkt, dass die Peptidsequenzen von gp41 und menschlichem IL-2 nicht homolog sind. In der Tat besitzen die beiden Proteine global untereinander nur eine Sequenzidentität von 16,5%, wobei diese Homologieschwelle nicht signifikant ist, die man leicht mit Hilfe von in silico durchgeführten Simulationen an Sequenzen der gleichen Zusammensetzung, bei denen jedoch die Ordnung der Aminosäuren willkürlich modifiziert worden ist, feststellen kann.

Frühere Arbeiten (Bost et al., Immunology 65 (1988), 611–615) haben eine Sequenzhomologie zwischen dem Protein gp41 und IL-2 (Sequenz LERILL) gezeigt. Es ist festzuhalten, dass diese Sequenz LERILL von gp41 keinen immunodominierenden Bereich dieses Proteins darstellt; siehe J. A. LEVY, Microbiol., Rev., 57 (1993), 183–289, insbesondere Seite 232. Die Sequenz LERILL befindet sich andererseits im Inneren des Virusteilchens; sie entspricht dem C-terminalen Ende von gp41.

Mit der Feststellung, dass IL-2 und die mit AIDS assoziierten Retroviren gemeinsame Targetzellen aufzuweisen scheinen, haben die Autoren der vorliegenden Erfindung die Hypothese aufgestellt, dass der Rezeptor für menschliches Interleukin-2 dem IL-2 und dem Protein gp41 des HIV gemeinsam sein könnte und haben demzufolge nach dreidimensionalen Strukturanalogien zwischen diesen beiden letzteren gesucht.

In der vorliegenden Beschreibung sind die Numerierungen der Aminosäurereste der Peptidsequenz von Interleukin-2 und von gp41 jene, die in der Datenbank SWISSPROT (Version 34) benutzt werden.

Die Peptidsequenzen von IL-2 und des Proteins gp41 sind bekannt. Im Rahmen der vorliegenden Anmeldung sei auf die folgenden veröffentlichten Sequenzen Bezug genommen:

  • – Für IL-2: Datenbank SWISSPROT (Version 34) Code IL2_HUMAN;
  • – für gp41: Datenbank SWISSPROT (Version 34) Code ENV_HV1BR.

Die verwendeten publizierten Strukturen sind die folgenden:

  • – Für IL-2: Datenbank PDB (Brookhaven Databank) 1IRL;
  • – für gp41: Datenbanken PDB (Brookhaven Databank)
  • – 1AIK,
  • – 1ENV.

Weiterhin ist die durch NMR bestimmte dreidimensionale Struktur von IL-2 bekannt (P. C. Mott et al., J. Mol. Biol., 248 (1995), 979), ebenso wie die Struktur in bestimmten Bereichen des Proteins gp41, welche mit Hilfe des Röntgenbeugungsspektrums bestimmt wurde (D. C. Chan et al., Cell, 89 (1997), 263–273; W. Weissenhorn et al., Nature, 387 (1997), 426–430). Andererseits wurde ein dreidimensionales Modell eines Teils der externen Domäne im Bereich 545–671 des Proteins gp41 (trimere Form) von den Erfindern der vorliegenden Erfindung durch Molekülmodellisierung ermittelt. Dieses Molekülmodell wurde erhalten unter Verwendung des Programms X-plor mit Hilfe einer Strategie, die ähnlich jener ist der Molekülmodellisierung unter den Einschränkungen des NMR. Die für die Molekülmodellisierung der trimeren Form erforderlichen Einschränkungen wurden abgeleitet von der dreidimensionalen Struktur der Mutante pII der Domäne "Leucine zipper" des Proteins GCN4 (Code PDB: 1GCM), die in Form eines Trimeren des Typs "Coiled coil" kristallisiert wurde.

Durch Untersuchung der erhaltenen Strukturen wurden dreidimensionale Analogien zwischen bestimmten Bereichen des Proteins gp41 und bestimmten Bereichen von Interleukin-2, die an der Bindung an seinen Rezeptor teilnimmt, gefunden. Der Bindungsmodus von IL-2 an seinen Rezeptor sowie die bei dieser Bindung beteiligten Bereiche von IL-2 sind in der Tat bekannt; siehe J. F. BAZAN, P.N.A.S. USA 87 (1990), 6934–6938; P. Bamborough et al., Structure, 2 (1994), 839–851; J. R. Gnarra et al., P.N.A.S. USA 87 (1990), 3440–3444; T. Takeshita et al., Science, 257 (1992), 379–382; und J. M. CAVAILLON, Les Cytokines (Masson, Paris, 1996), Seiten 119–125.

Diese Ergebnisse wurden durch globale Vergleichsuntersuchungen der Strukturen von gp41 und von IL-2 und durch lokale Untersuchungen bestätigt, die sich insbesondere für die analogen funktionellen Gruppen jeder der Strukturen interessieren, wie es oben bereits beschrieben worden ist.

Es wurde insbesondere gefunden, dass die Bereiche 53–61 und 88–93 von IL-2, die in Form einer Alpha-Helix organisiert sind, sich in zufriedenstellender Weise mit zwei der drei Helizes des zentralen Trimeren von gp41 überlagern. Dies lehrt, dass bei den beiden Proteinen die von den verschiedenen Helizes getragenen Gruppierungen relativ vergleichbare Eigenschaften bezüglich der Zugänglichkeit und der Organisation besitzen.

Es wurden weiterhin lokale dreidimensionale Strukturanalogien zwischen einem stark konservierten immunodominanten Bereich des Glykoproteins gp41 des HIV (genauer in dem Bereich von 545–682) und menschlichem Interleukin-2 gefunden.

Die Peptidsequenz des Bereichs 545–682 des Proteins gp41 von HIV1 (Datenbank SWISSPROT: ENV_HV1BR) ist in der beigefügten Tabelle 3 wiedergegeben.

In der beigefügten Tabelle 3bis sind die Peptidsequenzen von vier Abschnitten dieses Bereichs von gp41 (555–577, 572–601, 590–620 und 628–663) wiedergegeben, in denen man Strukturanalogien und/oder Kreuzreaktionen mit IL-2 festgestellt hat.

Die Abschnitte von IL-2, welche die erwähnten Strukturanalogien betreffen, sind die Abschnitte 27–47, 45–69, 99–121 und 131–153 von IL-2. Die Peptidsequenzen dieser Abschnitte sind in der folgenden Tabelle 4 angegeben.

Es ist wesentlich, dass der Abschnitt 27–47 von IL-2 an der Bindung von IL-2 an der Betakette seines Rezeptors beteiligt ist. In der Tat gehören die Aminosäuren des Abschnitts 27–47 der Helix A an, die an der Bindung an den Rezeptor IL-2 (RIL-2), genauer an dem beta-RIL-2, teilnimmt.

Die Aminosäuren des Abschnitts 45–69 gehören einem Bereich von IL-2 an, der an der Bindung an alpha-RIL-2 beteiligt ist.

Die Aminosäuren in dem Abschnitt 99–121 gehören der Helix E an, die an der Bindung an beta-RIL-2 beteiligt ist.

Die Aminosäuren in dem Abschnitt 131–153 von IL-2 gehören der Helix F an, die an der Bindung an gamma-RIL-2 teilnimmt.

Zur Erläuterung sind in der beigefügten Tabelle 4bis die Strukturanalogien dargestellt, welche zwischen dem Abschnitt 572–601 von gp41 und dem Abschnitt 27–47 von menschlichem IL-2 vorliegen. Die an dieser dreidimensionalen Strukturanalogie beteiligten externen Aminosäuren sind in der Tabelle 4bis unterstrichen.

Es sei festgehalten, dass ein und derselbe Abschnitt von gp41 dreidimensionale Strukturanalogien mit mehreren unterschiedlichen Abschnitt von IL-2 aufweisen kann.

Weiterhin haben die Autoren der Erfindung festgestellt, dass in dem Abschnitt 600–612 von gp41 die drei Lysine (K) in Position 606 an den drei primären Ketten von gp41 ein Konformationsepitop bilden können und diese Lysine von gp41 im Raum den Lysinen 52, 96 und 55 von IL-2 entsprechen können.

Es wurden weiterhin immunologische Kreuzreaktivitäten zwischen den Proteinen gp41 und IL-2 festgestellt. Insbesondere konnte unter Anwendung der Methoden ELISA und PEPSCAN unter Verwendung von durch Immunoreinigung über einer immobilisiertes menschliches IL-2 enthaltenden Säule gereinigten Antikörpern aus HIV+-Seren festgestellt werden, dass bestimmte dieser Antikörper die Abschnitte von IL-2 erkennen, die bei der Bindung von IL-2 an den alpha-, beta- und gamma-Ketten seines Rezeptors beteiligt sind und insbesondere an den Abschnitten, die der Helix A (KTQLQLEHLLLTLQ), der Helix E RPRDLISNINVIVLELK, der Helix F (TIVEFLNRWITFCQSIISTLT), der Brücke AB und dem Beginn der Helix B (NNYKNPKLTRMLTFKFYMFKK) beteiligt sind.

Unter Anwendung der Punktabscheidungstechniken auf Filter (oder "Dot") und Immunotransfertechniken des Typs Western Blot konnte weiterhin gezeigt werden, dass polyklonale Antikörper, die von Seren von HIV+-Kranken stammen und über menschlichem IL-2 immunogereinigt worden sind, die Oligomeren des Proteins gp41 erkennen.

Die durchgeführten Untersuchungen haben weiter gezeigt, dass die murinen und menschlichen monoklonalen Anti-gp41-antikörper, die gegen die konservierten immunodominierenden Bereiche des Proteins gp41 von HIV gerichtet sind, die Bereiche von IL-2 erkennen, die an der Bindung dieses letzteren an den alpha-, beta- und gamma-Ketten des Rezeptors von IL-2 teilnehmen.

Man kann demzufolge erfindungsgemäß Impfstoffe gegen das HIV-Virus gewinnen insbesondere durch Herstellung der Polypeptide, die mindestens einen der in der Tabelle 3bis beschriebenen Abschnitte von gp41 enthalten, welche Polypeptide in modifizierter Form vorliegen, das heißt, mindestens eine Mutation aufweisen, wie es oben beschrieben worden ist. Es ist festzuhalten, dass die Aufspaltung des Bereichs 545–682 in Abschnitte einen gewissen willkürlichen Charakter aufweisen können, was der Grund dafür ist, dass bestimmte angegebene Abschnitte sich überschneiden können.

BEISPIEL 2 = Mutationen an gp41 von HIV1.

Man bereitet unter Anwendung bekannter Verfahrensweisen mutierte Hüll-Glykoproteine von gp41. Diese Mutationen sind in der beigefügten Tabelle 5 dargestellt, welche die betreffende Sequenz von gp41 wiedergibt und unter dieser Sequenz ausgerichtet die mutierten Sequenzen. Das Ausmaß der Mutationen ist durch Unterstreichen der betreffenden Aminosäuren hervorgehoben.

Man bereitet Impfstoffzubereitungen, die jeweils in wässriger, steriler und pyrogenfreier Salzlösung eines der in der oben beschriebenen Weise erhaltenen mutierten gp41-Proteine enthalten.

Man immunisiert Kaninchen oder Mäuse mit den erhaltenen mutierten Proteinen und untersucht, ob die durch diese Tiere entwickelten Antikörper menschliches Interleukin-2 erkennen oder nicht erkennen, beispielsweise unter Verwendung der ELISA- oder PEPSCAN-Technik. Man selektioniert die mutierten Proteine, welche die Bildung von Antikörpern induzieren, die IL-2 nicht erkennen, jedoch das Protein gp41 erkennen.

Die PEPSCAN-Technik ist beschrieben worden von J. WORTHINGTON und K. MORGAN, "Epitope mapping using synthetic peptides", in "PEPTIDE ANTIGENS – A practical approach" (G. B. WISDOW Hrgb.), Oxford University Press (1994).

TABELLE 1
EIAV
steht für das Virus der infektiösen Pferdeanämie
CAEV
steht für das Virus der Ziegenenzephalitis
FIV
steht für das Katzen-Immunodefizienzvirus
SIV
steht für das Affen-Immunodefizienzvirus
HIV
steht für das menschliche Immunodefizienzvirus
TABELLE 2a
TABELLE 2a (Fortsetzung)
TABELLE 2b
TABELLE 2c
TABELLE 3 gp41 (Bereich 545–682)
TABELLE 3bis Abschnitte von gp41 Abschnitt 555–577 QQQNNLLRAIEAQQHLLQLTVWG Abschnitt 572–601 QLTVWGIKQLQARILAVERYLKDQQLLGIW Abschnitt 590–620 RYLKDQQLLGIWGCSGKLICTTAVPWNASWS Abschnitt 628–663 WNNMTWMEWDREINNYTSLIHSLIEESQNQQEKNEQ
TABELLE 4
TABELLE 4Bis
TABELLE 5 Mutationen im Bereich des Abschnitts 555–577 Abschnitt 555–577 QQQNNLLRAIEAQQHLLQLTVWG Mutation 1: QQQNNLLAAIEAQQHLLQLTVWG Mutation 2: QQQNNLLRAIERQQHLLQLTVWG Mutation 3: QQQNNLLAAIERQQHLLQLTVWG Mutation 4: QQQNNLLRAIEAQQELLQLTVWG Mutation 5: QQQNNLLRAIEAQQQLLQLTVWG Mutation 6: QQQNNLLRAIEAQQHLLRLTVWG Mutation 7: QQQNNLLRAIEAQQHLLKLTVWG Mutation 8: QQQNNLLRAIEAQQQLLKLTVWG
TABELLE 5 (Fortsetzung) Mutationen im Bereich des Abschnitts 572–601 Abschnitt 572–601 QLTVWGIKQLQARILAVERYLKDQQLLGIW Mutation 1: QLTVWGIKQLQARILAVERYLKAQQLLGIW Mutation 2: QLTVWGIKQLQARILAVEAYLKDQQLLGIW Mutation 3: QLTVTWGIKQLQARILAVEAYLKAQQLLGIW Mutation 4: QLTVWGIKQLQARILAVEDYLKRQQLLGIW Mutation 5: QLTVWGIKQLQARITAVERYLKDQQLLGIW
Mutationen im Bereich des Abschnitts 590–620 Abschnitt 590–620 RYLKDQQLLGIWGCSGKLICTTAVPWNASWS Mutation 1: KYLKDQQLLGIWGCSGKLICTTAVPWNASWS Mutation 2: RYLKDQALLGIWGCSGKLICTTAVPWNASWS Mutation 3: RYLKDQQQLGIWGCSGKLICTTAVPWNASWS Mutation 4: RYLKDQAQLGIWGCSGKLICTTAVPWNASWS Mutation 5: RYLKDQARLGIWGCSGKLICTTAVPWNASWS Mutation 6: RYLKDQQLLNSWGCSGKLICTTAVPWNASWS Mutation 7: RYLKDQQLLGIWGCSQKLICTTAVPWNASWS Mutation 8: RYLKDQQLLGIWGCSFKLICTTAVPWNASWS Mutation 9: RYLKDQQLLGIWGCSGKLICTTAVPWNASSS Mutation 10: RYLKDQQLLGIWGCSGKLICTTAVPWNADTL Mutation 11: RYLKDQQLLGIWGCSGKLICTTAVPWNATNR Mutation 12: RYLKDQQLLGIWGCSGKLICTTAVPWNANTR Mutation 13: RYLKDQQLLGIWGCSGKLICTTAVPWNANTS
Mutationen im Bereich des Abschnitts 628–663 Abschnitt 628–663 WNNMTWMEWDREINNYTSLIHSLIEESQNQQEKNEQ Mutation 1: WNNMTWMEWDREINNYESLIHSLIEESQNQQEKNEQ Mutation 2: WNNMTWMEWDREINNYTSNIHSLIEESQNQQEKNEQ


Anspruch[de]
Verfahren zur Suche und Gewinnung eines Impfstoffs gegen die pathogenen Wirkungen, die mit der Infektion eines tierischen oder menschlichen Wirts durch ein HIV-Retrovirus, das dazu in der Lage ist, in eine Target-Zelle des Wirts einzudringen, verbunden sind, welche Target-Zelle einen Membran-Rezeptor für das Wirts-Interleukin-2 (IL-2)-Protein aufweist, gemäß dem man:

a) impfende Mittel bildet auf der Grundlage eines Polypeptids, das mindestens einen Teil des Hüll-Proteins gp41 eines pathogenen Stamms des Retrovirus umfasst, welches Polypeptid in einer modifizierten Form in den impfenden Mitteln vorliegt,

– wobei der Teil des Hüll-Proteins gp41 aus jenen ausgewählt wird, die mindestens ein Fragment eines immunodominierenden Bereichs des Hüll-Proteins gp41 umfassen, welches Fragment mindestens eine Aminosäure enthält, die eine Aminosäure aus dem immunodominierenden Bereich ist und die in dem pathogenen Stamm vorhanden ist,

– welches Polypeptid aus jenen ausgewählt ist, die in nicht-modifiziertem Zustand eine Immunantwort induzieren, die gleichzeitig gegen den immunodominierenden Bereich und gegen das Wirts-IL-2-Protein gerichtet ist, und

b) als Impfstoff ein solches modifiziertes Polypeptid aus jenen auswählt, die eine Immunantwort induzieren, welche gegen den immunodominierenden Bereich, jedoch nicht gegen das Wirts-IL-2-Protein gerichtet ist.
Verfahren nach Anspruch 1, worin der immunodominierende Bereich ausgewählt ist

– aus jenen, welche eine Kreuzreaktion des Typs B und/oder des Typs T mit dem Wirts-IL-2-Protein ergeben, und/oder

– aus jenen, für die man zuvor eine dreidimensionale Strukturanalogie mit einem Teil des Wirts-IL-2-Proteins festgestellt hat.
Verfahren nach einem der vorhergehenden Ansprüche, worin:

– das impfende Mittel in modifizierter Form ein Polypeptid enthält, welches mindestens einen Teil des Bereichs 545–682 des Proteins gp41 von HIV 1 enthält.
Verfahren nach einem der vorhergehenden Ansprüche, worin das impfende Mittel ein Oligomer mindestens eines Teils des Hüllproteins gp41 des HIV-Retrovirus in modifizierter Form ist. Verfahren nach einem der vorhergehenden Ansprüche, worin die modifizierten Polypeptide durch die Bildung von Mimotopen erhalten worden sind. Impfendes Mittel, erhältlich nach dem Verfahren gemäß einem der Ansprüche 1 bis 5. Impfendes Mittel gegen die pathogenen Wirkungen, die mit der Infektion eines tierischen oder menschlichen Wirts durch ein HIV-Retrovirus verbunden sind,

welches Retrovirus dazu in der Lage ist, in eine Target-Zelle des Wirts einzudringen, welche Target-Zelle einen Membran-Rezeptor für das Wirts-Interleukin-2 (IL-2) aufweist,

welches Retrovirus ein Hüllprotein gp41 besitzt, welches eine Immunantwort induziert, die gleichzeitig gegen einen beibehaltenden und immunodominierenden Bereich des Hüllproteins gp41 und gegen das Wirts-IL-2-Protein gerichtet ist,

welches impfende Mittel dazu in der Lager ist, eine Immunantwort zu induzieren, die gegen den Bereich des Hüllproteins gp41 und nicht gegen das Protein IL-2 gerichtet ist.
Impfendes Mittel nach dem vorhergehenden Anspruch, welches ein Mimotop mindestens eines Teils des beibehaltenden und immunodominierenden Bereichs ist. Antikörper, erhältlich durch Immunisierung mit Hilfe eines Impfstoffs nach einem der Ansprüche 6 bis 8, welche Antikörper das Hüllprotein gp41 und nicht das Wirts-Interleukin-2-Protein erkennen. Pharmazeutische Zubereitung, enthaltend einen Antikörper nach Anspruch 9. Verwendung eines modifizierten Polypeptids, welches nach dem Verfahren nach einem der Ansprüche 1 bis 5 erhältlich ist, für die Herstellung einer Impfzubereitung zur Vorbeugung der pathogenen Wirkungen, die mit der Infektion eines tierischen oder menschlichen Wirts durch ein HIV-Retrovirus, das dazu in der Lage ist, in eine Target-Zelle des Wirts einzudringen, verbunden sind, welche Target-Zelle einen Membran-Rezeptor für das Wirts-Interleukin-2-Protein aufweist, und welches Retrovirus ein Hüllprotein gp41 aufweist, welches eine Immunantwort induziert, die gleichzeitig gegen einen beibehaltenden und immunodominierenden Bereich des Hüllproteins gp41 und gegen das Wirts-Interleukin-2-Protein gerichtet ist. Verwendung eines impfenden Mittels nach einem der Ansprüche 6 bis 8 bei der Herstellung einer impfenden Zubereitung gegen das Retrovirus. Polynucleotid, welches für ein modifiziertes Polypeptid, wie es in einem der Ansprüche 1 bis 5 definiert ist, codiert, und Expressionsvektor enthaltend das Polynucleotid.






IPC
A Täglicher Lebensbedarf
B Arbeitsverfahren; Transportieren
C Chemie; Hüttenwesen
D Textilien; Papier
E Bauwesen; Erdbohren; Bergbau
F Maschinenbau; Beleuchtung; Heizung; Waffen; Sprengen
G Physik
H Elektrotechnik

Anmelder
Datum

Patentrecherche

Patent Zeichnungen (PDF)

Copyright © 2008 Patent-De Alle Rechte vorbehalten. eMail: info@patent-de.com