PatentDe  


No Patent No Titel
1 DE212006000031U1 Inhalatorvorrichtungszähler
2 DE60312715T2 VERWENDUNG VON DEM QUINAZOLIN DERIVAT ZD6474 KOMBINIERT MIT GEMCITABIN UND GEGEBENENFALLS IONISIERENDER STRAHLUNG FÜR DIE BEHANDLUNG VON KREBS
3 DE60311788T2 KOMBINATIONSTHERAPIE ZUR BEHANDLUNG VON KREBS
4 DE60311643T2 VERFAHREN ZUR ANALYSE VON PHARMAZEUTISCHEN PROBEN
5 EP1838733 GEGEN ANGIOPOIETIN-2 GERICHTETE ANTIKÖRPER UND ANWENDUNGEN DAVON
6 EP1838325 NEUE VERWENDUNG VON PIPERAZIN-1-YLDIBENZO ÄB,FÜÄ1,4ÜTHIAZEPIN ODER SEINES PHARMAZEUTISCH ANNEHMBAREN SALZES UND ORALE PHARMAZEUTISCHE ZUSAMMENSETZUNGEN
7 EP1833487 NEUE VERWENDUNG VON GABAB-REZEPTOR-AGONISTEN
8 DE60126923T2 THERAPEUTISCHE ZUSAMMENSETZUNGEN BESTEHEND AUS ANTIHYPOTENSIVA UND ANTIANGIOGENIKA
9 DE60033524T2 FILTERVORRICHTUNG
10 DE60125163T2 VERFAHREN ZUR ÜBERWACHUNG EINES GEFRIERTROCKNUNGSVERFAHRENS
11 EP1831674 SPEKTROSKOPIEVERFAHREN
12 EP1830972 VERARBEITUNGSVERFAHREN
13 EP1828394 CHEMISCHES VERFAHREN
14 DE69737188T2 MONOKLONALER ANTIKOERPER GEGEN CEA, KONJUGATE DIE DIESES ANTIKOERPER ENTHALTEN UND DEREN THERAPEUTISCHE VERWENDUNG IN EINEM ADEPT-SYSTEM
15 DE60125801T2 7-AMINO-2-ALKYLTHIOPTERIDIN-4-YL-AMINE ZUR BEHANDLUNG VON CHEMOKINASSOZIIERTEN ERKRANKUNGEN
16 EP1819339 KOMBINATION AUS N-(3-METHOXY-5-METHYLPYRAZIN-2-YL)-2-(4-`1,3,4-OXADIAZOL-2-YL_PHENYL)PYRIDIN-3-SULFONAMID UND EINEM ANTIMITOTISCHEN MITTEL ZUR BEHANDLUNG VON KREBS
17 DE60217136T2 BENZOTHIAZEPIN UND BENZOTHIADIAZEPIN DERIVATIVE MIT HEMMENDER WIRKUNG AUF DEN SÄURETRANSPORT IN DEN GALLENGÄNGEN ZUR BEHANDLUNG VON HYPERLIPIDAEMIA
18 DE602004003489T2 HYBRID TOPOISOMERASEN UND IHRE VERWENDUNG
19 EP1802539 INHALATORVENTIL
20 EP1795199 Quetiapin für die Behandlung von Substanzabhängigkeit oder Substanzmissbrauch
21 DE60215525T2 KOMBINATION AUS QUETIAPIN UND ZOLMITRIPTAN
22 DE60119742T2 METHODE ZUR BEHANDLUNG DER HYPERAKTIVEN BLASE
23 EP1760066 Verfahren zur Herstellung von Cyclopropancarbonsäurederivaten und durch diese Verfahren zur Verfügung gestellte Zwischenprodukte
24 DE69836023T2 Neue Formulierung
25 EP1755988 DURCHMESSERMESSVORRICHTUNG
26 DE60213845T2 KOMBINATIONSTHERAPIE MIT ZD6474 UND EINEM TAXAN
27 DE69736445T2 Refluxinhibitoren
28 DE60211139T2 FESTE ARZNEIZUSAMMENSETZUNG ENTHALTEND 4'-CYANO-TRIFLUORO-3-(4-FLUOROPHENYLSULPHONYL) -2-HYDROXY-2-METHYLPROPIONO- M TOLUIDIDE UND PVP
29 EP1740170 KOMBINATIONSTHERAPIE MIT EINEM ANTITUMORALEN MITTEL AUS AZD2171 UND PLATIN
30 EP1328319 7-AMINO-2-ALKYLTHIOPTERIDIN-4-YL-AMINE ZUR BEHANDLUNG VON CHEMOKINASSOZIIERTEN ERKRANKUNGEN
31 EP1427423 BENZOTHIAZEPIN UND BENZOTHIADIAZEPIN DERIVATIVE MIT HEMMENDER WIRKUNG AUF DEN SÄURETRANSPORT IN DEN GALLENGÄNGEN ZUR BEHANDLUNG VON HYPERLIPIDAEMIA
32 DE69834955T2 Neue Verwendung von Budesonide und Formoterol
33 EP1727738 BEHÄLTER FÜR TABLETTEN UND VERFAHREN ZUR HERSTELLUNG SOLCH EINES BEHÄLTERS
34 DE69930947T2 PIPERAZIN-4-PHENYL-DERIVATE ALS INHIBITOREN DER WECHSELWIRKUNG ZWISCHEN MDM2 UND MDM2
35 DE69931904T2 EINBAU AKTIVER SUBSTANZEN IN TRÄGERMATRIZEN
36 EP1713488 BEHANDLUNG VON PSYCHOSEN MIT EINEM QUETIAPIN-ANTIPSYCHOTIKUM
37 EP1423112 KOMBINATION AUS QUETIAPIN UND ZOLMITRIPTAN
38 EP1706120 NEUE DERIVATIVE VON 6- 4 4 - 1 H - INDOL-2-SULFONYL) PIPERAZIN-1-CARBONYLPHENYLPYRADIZIN-3-ON
39 DE69930158T2 VERFAHREN ZUR HERSTELLUNG VON PARTIKELN MIT EINEM AUS DEM AMORPHEN UND/ODER METASTABILEN KRISTALLINEN ZUSTAND IN EINEN KRISTALLINEN ZUSTAND ÜBERFÜHRTEN BEREICH
40 DE60117701T2 TESTVERFAHREN FÜR AGONISTEN ODER ANTAGONISTEN DER BINDUNG VON DYNORPHIN A AN DEN MAS-REZEPTOR
41 EP1687622 VORRICHTUNG ZUM DURCHSTOSSEN EINES BEHÄLTERS
42 EP1678499 CHEMISCHE VERBINDUNG UND TEST
43 DE69534696T2 Parenterale Fettemulsionen, die EDTA als Konservierungsmittel enthalten
44 DE60023034T2 CD45 HEMMER
45 EP1661563 Glukokinase beeinflussende Verbindungen
46 EP1658069 HETEROZYKLISCHE AMIDDERIVATE, DIE GLYCOGEN PHOSPHORYLASE INHIBIERENDE AKTIVITÄT BESITZEN
47 EP1656136 HETEROCYCLISCHE AMID-DERIVATE MIT GLYCOGEN-PHOSPHORYLASE-HEMMER-WIRKUNG
48 DE69831668T2 AUF T7 PROMOTOR BASIERENDES EXPRESSIONSSYSTEM
49 EP1381358 FESTE ARZNEIZUSAMMENSETZUNG ENTHALTEND 4'-CYANO-TRIFLUORO-3-(4-FLUOROPHENYLSULPHONYL) -2-HYDROXY-2-METHYLPROPIONO- M TOLUIDIDE UND PVP
50 DE60113255T2 NEUE FORMULIERUNGEN VON -G(A)-2,4-DISULFOPHENYL-N-TERT-BUTYLNITRON
51 EP1649263 ZUSAMMENGESETZTE NANOPARTIKEL
52 EP1644005 METABOLIT VON QUETIAPINE
53 EP1346221 TESTVERFAHREN FÜR AGONISTEN ODER ANTAGONISTEN DER BINDUNG VON DYNORPHIN A AN DEN MAS-REZEPTOR
54 EP1615874 NEUE NICHTIONISCHE TENSIDE ZUR SOLUBILISIERUNG VON SCHLECHT LÖSLICHEN MOLEKÜLEN
55 DE69634492T2 MEDIKAMENTEN-VORSTUFEN FÜR THROMBIN-INHIBITOREN
56 EP1620104 THERAPEUTISCHE VERBINDUNGEN ENTHALTEND EINEN ANTI-ANGIOGENITISCHEN WIRKSTOFF IN KOMBINATION MIT EINEM SRC-INHIBITOR UND IHRE THERAPEUTISCHE VERWENDUNG
57 DE69828886T2 NEUARTIGE FORMULIERUNG ZUR INHALATION MIT EINER BULKDICHTE ZWISCHEN 0.28 UND 0.38 G/ML, VERFAHREN ZUR HERSTELLUNG DER FORMULIERUNG SOWIE ANWENDUNG DERSELBEN
58 DE69826845T2 VERFAHREN ZUR HERSTELLUNG VON ARYLSULFONYLCHLORID
59 DE60109799T2 VERWENDUNG VON QUETIAPIN FÜR AUFMERKSAMKEITSMANGEL-HYPERAKTIVITÄTSSTÖRUNGEN ODER VERHALTENSSTÖRUNGEN
60 EP1578417 1,5-DIARYL-PYRROL-3-CARBOXAMID- DERIVATE UND IHRE VERWENDUNG ALS CANNABINOID RECEPTOR MODULATOREN
61 DE60019116T2 NEUE OMEPRAZOLE UND (S)-OMEPRAZOLE ZUSAMMENSETZUNG
62 EP0994954 AUF T7 PROMOTOR BASIERENDES EXPRESSIONSSYSTEM
63 DE69731747T2 PEPTID DERIVATE
64 DE60020401T2 NAPHTHOQUINONDERIVATIVE ALS CD45 INHIBITOREN
65 DE69733260T2 VERFAHREN UND VORRICHTUNG ZUM DOSIEREN EINER PULVERFÖRMIGEN SUBSTANZ SOWIE ANORDNUNG MIT EINER VIELZAHL SOLCHER VORRICHTUNGEN
66 EP1599432 ADAMANTANDERIVATE, VERFAHREN ZU DEREN HERSTELLUNG UND PHARMZEUTISCHE ZUSAMMENSETZUNG, DIE DIESE ENTHÄLT
67 EP1596847 NEUE KOMBINATION
68 DE69731981T2 NEUE VERBESSERTE FORMULIERUNG ZUR BEHANDLUNG VON THROMBOEMBOLISMUS
69 EP1595146 SCREENING-TESTS FÜR CANNABINOID-LIGAND-ARTIGE MODULATOREN VON GPR55
70 EP1592451 STABILE DISPERSION FESTER TEILCHEN MIT EINER WASSERUNLÖSLICHEN PYRAZIN-VERBINDUNG
71 DE60202351T2 NEUER FILMÜBERZUG
72 DE60015796T2 NEUE AMINOPROPYLPHOSPHINSÄUREN
73 EP1294369 NEUE FORMULIERUNGEN VON -G(A)-2,4-DISULFOPHENYL-N-TERT-BUTYLNITRON
74 DE69533485T2 NEUE POLYPEPTIDE
75 DE69533470T2 AUS MEHREREN EINZELEINHEITEN ZUSAMMENGESETZTES PHARMAZEUTISCHES PRÄPARAT, DAS EINEN PROTONENPUMPENINHIBITOR ENTHÄLT
76 DE60013471T2 NEUE HYDRONAPHTHALENE, HERGESTELLT DURCH EINE RHODIUM-KATALYSIERTE RINGÖFFNUNGSREAKTION IN ANWESENHEIT EINES PHOSPHINLIGANDEN
77 DE60012745T2 NEUE VERWENDUNG VON VERBINDUNGEN ALS ANTIBAKTERIELLE MITTEL
78 DE69920946T2 VERFAHREN ZUR HERSTELLUNG KRISTALLINER PARTIKEL
79 DE69920945T2 VERFAHREN ZUR HERSTELLUNG VON ARZNEISTOFFPARTIKELN
80 DE69918541T2 VERWENDUNG VON NMDA ANTAGONISTEN ZUR BEHANDLUNG DES REIZKOLONS
81 EP1549600 KETONE
82 EP1543330 VERFAHREN ZUR IDENTIFIZIERUNG VON LIGANDEN VON FPRL-1
83 DE69918972T2 VERWENDUNG VON NMDA-ANTAGONISTEN UND/ODER NATRIUMKANALANTAGONISTEN ZUR BEHANDLUNG VON ENTZÜNDLICHEN ERKRANKUNGEN
84 DE60011635T2 VERWENDUNG VON CYCLODEXTRINE ZUR GESCHÜTZTEN AUFBEWAHRUNG VON BIBLIOTHEKEN CHEMISCHER VERBINDUNGEN
85 DE60103627T2 SELBSTEMULGIERENDES ARZNEISTOFFVERABREICHUNGSSYSTEM, wobei das Fettmittel optional ist
86 EP0920607 VERFAHREN UND VORRICHTUNG ZUM DOSIEREN EINER PULVERFÖRMIGEN SUBSTANZ SOWIE ANORDNUNG MIT EINER VIELZAHL SOLCHER VORRICHTUNGEN
87 DE69533294T2 Pulverformulierungen, die Melezitose als Verdünnungsmittel enthalten
88 EP1326616 VERWENDUNG VON QUETIAPIN FÜR AUFMERKSAMKEITSMANGEL-HYPERAKTIVITÄTSSTÖRUNGEN ODER VERHALTENSSTÖRUNGEN
89 EP1515984 PEPTIDDERIVATE MIT EINER THIAZEPINGRUPPE ZUR BEHANDLUNG DER HYPERLIPIDÄMIE
90 DE60009953T2 NEUARTIGES VERFAHREN
91 DE69915823T2 VERWENDUNG VON VERBINDUNGEN ZUR ERHÖHUNG DER PYRUVATDEHYDROGENASEAKTIVITÄT
92 DE69915826T2 VERFAHREN, VORRICHTUNG UND ANLAGE ZUM BEFÜLLEN VON BEHÄLTERN
93 DE69822490T2 KOMBINATION EINES SELEKTIVEN 5-HT1A ANTAGONISTEN UND EINES SELEKTIVEN h5-HT1B ANTAGONISTEN ODER PARTIELLEN AGONISTEN
94 EP1498406 Neue Hydronaphthalene, hergestellt durch eine rhodium-katalysierte Ringöffnungsreaktion in Anwesenheit eines Phosphinliganden
95 DE69915814T2 VERFAHREN, VORRICHTUNG UND ANLAGE ZUM BEFÜLLEN VON BEHÄLTERN
96 DE20380218U1 Blister-Verpackungsvorrichtung
97 DE69532661T2 Lesevorrichtung für einen passiven Behälter
98 EP1493013 VORRICHTUNG UND VERFAHREN ZUM PRÜFEN UNTER DRUCK STEHENDER BEHÄLTER DURCH EINGRIFFSFREIE MITTEL
99 DE69915465T2 VERFAHREN, VORRICHTUNG UND ANLAGE ZUM BEFÜLLEN VON BEHÄLTERN
100 EP1355635 NEUER FILMÜBERZUG
1 2

IPC
A Täglicher Lebensbedarf
B Arbeitsverfahren; Transportieren
C Chemie; Hüttenwesen
D Textilien; Papier
E Bauwesen; Erdbohren; Bergbau
F Maschinenbau; Beleuchtung; Heizung; Waffen; Sprengen
G Physik
H Elektrotechnik

Anmelder
Datum

Patentrecherche

Copyright © 2008 Patent-De Alle Rechte vorbehalten. eMail: info@patent-de.com